LOCUS NC_002516 903 bp DNA linear CON 24-JAN-2019
DEFINITION Pseudomonas aeruginosa PAO1, complete genome.
ACCESSION NC_002516 REGION: 1373945..1374847
VERSION NC_002516.2
DBLINK BioProject: PRJNA57945
Assembly: GCF_000006765.1
KEYWORDS RefSeq.
SOURCE Pseudomonas aeruginosa PAO1
ORGANISM Pseudomonas aeruginosa PAO1
Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
Pseudomonadales; Pseudomonadaceae; Pseudomonas.
REFERENCE 1 (bases 1 to 903)
AUTHORS Winsor,G.L., Van Rossum,T., Lo,R., Khaira,B., Whiteside,M.D.,
Hancock,R.E. and Brinkman,F.S.
TITLE Pseudomonas Genome Database: facilitating user-friendly,
comprehensive comparisons of microbial genomes
JOURNAL Nucleic acids Res. 37 (DATABASE ISSUE), D483-D488 (2009)
PUBMED 18978025
REFERENCE 2 (bases 1 to 903)
AUTHORS Cirz,R.T., O'Neill,B.M., Hammond,J.A., Head,S.R. and Romesberg,F.E.
TITLE Defining the Pseudomonas aeruginosa SOS response and its role in
the global response to the antibiotic ciprofloxacin
JOURNAL J. Bacteriol. 188 (20), 7101-7110 (2006)
PUBMED 17015649
REFERENCE 3 (bases 1 to 903)
AUTHORS Palmer,K.L., Mashburn,L.M., Singh,P.K. and Whiteley,M.
TITLE Cystic fibrosis sputum supports growth and cues key aspects of
Pseudomonas aeruginosa physiology
JOURNAL J. Bacteriol. 187 (15), 5267-5277 (2005)
PUBMED 16030221
REFERENCE 4 (bases 1 to 903)
AUTHORS Salunkhe,P., Smart,C.H., Morgan,J.A., Panagea,S., Walshaw,M.J.,
Hart,C.A., Geffers,R., Tummler,B. and Winstanley,C.
TITLE A cystic fibrosis epidemic strain of Pseudomonas aeruginosa
displays enhanced virulence and antimicrobial resistance
JOURNAL J. Bacteriol. 187 (14), 4908-4920 (2005)
PUBMED 15995206
REFERENCE 5 (bases 1 to 903)
AUTHORS Filiatrault,M.J., Wagner,V.E., Bushnell,D., Haidaris,C.G.,
Iglewski,B.H. and Passador,L.
TITLE Effect of anaerobiosis and nitrate on gene expression in
Pseudomonas aeruginosa
JOURNAL Infect. Immun. 73 (6), 3764-3772 (2005)
PUBMED 15908409
REFERENCE 6 (bases 1 to 903)
AUTHORS Rasmussen,T.B., Bjarnsholt,T., Skindersoe,M.E., Hentzer,M.,
Kristoffersen,P., Kote,M., Nielsen,J., Eberl,L. and Givskov,M.
TITLE Screening for quorum-sensing inhibitors (QSI) by use of a novel
genetic system, the QSI selector
JOURNAL J. Bacteriol. 187 (5), 1799-1814 (2005)
PUBMED 15716452
REFERENCE 7 (bases 1 to 903)
AUTHORS Winsor,G.L., Lo,R., Sui,S.J., Ung,K.S., Huang,S., Cheng,D.,
Ching,W.K., Hancock,R.E. and Brinkman,F.S.
TITLE Pseudomonas aeruginosa Genome Database and PseudoCap: facilitating
community-based, continually updated, genome annotation
JOURNAL Nucleic acids Res. 33 (DATABASE ISSUE), D338-D343 (2005)
PUBMED 15608211
REFERENCE 8 (bases 1 to 903)
AUTHORS Wagner,V.E., Bushnell,D., Passador,L., Brooks,A.I. and
Iglewski,B.H.
TITLE Microarray analysis of Pseudomonas aeruginosa quorum-sensing
regulons: effects of growth phase and environment
JOURNAL J. Bacteriol. 185 (7), 2080-2095 (2003)
PUBMED 12644477
REFERENCE 9 (bases 1 to 903)
AUTHORS Schuster,M., Lostroh,C.P., Ogi,T. and Greenberg,E.P.
TITLE Identification, timing, and signal specificity of Pseudomonas
aeruginosa quorum-controlled genes: a transcriptome analysis
JOURNAL J. Bacteriol. 185 (7), 2066-2079 (2003)
PUBMED 12644476
REFERENCE 10 (bases 1 to 903)
AUTHORS Stover,C.K., Pham,X.Q., Erwin,A.L., Mizoguchi,S.D., Warrener,P.,
Hickey,M.J., Brinkman,F.S., Hufnagle,W.O., Kowalik,D.J., Lagrou,M.,
Garber,R.L., Goltry,L., Tolentino,E., Westbrock-Wadman,S., Yuan,Y.,
Brody,L.L., Coulter,S.N., Folger,K.R., Kas,A., Larbig,K., Lim,R.,
Smith,K., Spencer,D., Wong,G.K., Wu,Z., Paulsen,I.T., Reizer,J.,
Saier,M.H., Hancock,R.E., Lory,S. and Olson,M.V.
TITLE Complete genome sequence of Pseudomonas aeruginosa PA01, an
opportunistic pathogen
JOURNAL Nature 406 (6799), 959-964 (2000)
PUBMED 10984043
REFERENCE 11 (bases 1 to 903)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (06-OCT-2010) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 12 (bases 1 to 903)
AUTHORS Winsor,G.L., Hancock,R.E. and Brinkman,F.S.
CONSRTM Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
TITLE Direct Submission
JOURNAL Submitted (08-SEP-2010) Department of Molecular Biology and
Biochemisry, Simon Fraser University, 8888 University Dr., Burnaby,
British Columbia V5A 1S6, Canada
REMARK protein update by submitter
REFERENCE 13 (bases 1 to 903)
AUTHORS Winsor,G.L., Hancock,R.E. and Brinkman,F.S.
CONSRTM Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
TITLE Direct Submission
JOURNAL Submitted (02-OCT-2008) Department of Molecular Biology and
Biochemisry, Simon Fraser University, 8888 University Dr., Burnaby,
British Columbia V5A 1S6, Canada
REMARK protein update by submitter
REFERENCE 14 (bases 1 to 903)
AUTHORS Winsor,G.L., Hancock,R.E. and Brinkman,F.S.
CONSRTM Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
TITLE Direct Submission
JOURNAL Submitted (05-JUL-2006) Department of Molecular Biology and
Biochemisry, Simon Fraser University, 8888 University Dr., Burnaby,
British Columbia V5A 1S6, Canada
REMARK Sequence update by submitter
REFERENCE 15 (bases 1 to 903)
AUTHORS Ung,K.S., Hancock,R.E. and Brinkman,F.S.
CONSRTM Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
TITLE Direct Submission
JOURNAL Submitted (04-FEB-2003) Department of Molecular Biology and
Biochemistry, Simon Fraser University, 8888 University Dr.,
Burnaby, British Columbia V5A 1S6, Canada
REFERENCE 16 (bases 1 to 903)
AUTHORS Stover,C.K., Pham,X.-Q.T., Erwin,A.L., Mizoguchi,S.D., Warrener,P.,
Hickey,M.J., Brinkman,F.S.L., Hufnagle,W.O., Kowalik,D.J.,
Lagrou,M., Garber,R.L., Goltry,L., Tolentino,E.,
Westbrock-Wadman,S., Yuan,Y., Brody,L.L., Coulter,S.N.,
Folger,K.R., Kas,A., Larbig,K., Lim,R.M., Smith,K.A., Spencer,D.H.,
Wong,G.K.-S., Wu,Z., Paulsen,I.T., Reizer,J., Saier,M.H.,
Hancock,R.E.W., Lory,S. and Olson,M.V.
CONSRTM Pseudomonas aeruginosa Community Annotation Project (PseudoCap)
TITLE Direct Submission
JOURNAL Submitted (16-MAY-2000) Department of Medicine and Genetics,
University of Washington Genome Center, University Of Washington,
Box 352145, Seattle, WA 98195, USA
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence is identical to AE004091.
On Jul 24, 2006 this sequence version replaced NC_002516.1.
RefSeq Category: Reference Genome
FGS: First Genome sequenced
MOD: Model Organism
UPR: UniProt Genome
-----------------------------------------------------------------
This represents the Sept 08, 2010 version of the continually
updated, reviewed, Pseudomonas aeruginosa PAO1 genome annotation
from PseudoCap (see http://www.pseudomonas.com for the latest
updates and links to alternate annotations). This update includes
updated base pair coordinates and new features. PseudoCap is
coordinated by Fiona S.L. Brinkman (Simon Fraser University,
Canada) and Robert E.W. Hancock (University of British Columbia,
Canada) with database development by Geoff Winsor (Simon Fraser
University). We welcome submission through
www.pseudomonas.com of any proposed changes.
'protein name confidence' is used to rate our confidence of the
accuracy of the protein name.
class 1: Function experimentally demonstrated in P. aeruginosa.
class 2: Function of highly similar gene experimentally
demonstrated in another organism (and gene context consistent in
terms of pathways its involved in, if known).
class 3: Function proposed based on presence of conserved amino
acid motif, structural feature or limited sequence similarity to an
experimentally studied gene.
class 4: Homologs of previously reported genes of unknown function,
or no similarity to any previously reported sequences.
------------------------------------------------------------------.
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..903
/organism="Pseudomonas aeruginosa PAO1"
/mol_type="genomic DNA"
/strain="PAO1"
/db_xref="taxon:208964"
gene 1..903
/locus_tag="PA1265"
/db_xref="GeneID:881343"
CDS 1..903
/locus_tag="PA1265"
/note="'Product name confidence: class 4 (Homologs of
previously reported genes of unknown function, or no
similarity to any previously reported sequences)'"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_249956.1"
/db_xref="GeneID:881343"
/translation="MRATTCTPRAMPGATRLLAVQLGMVLAWSSGFVGYRYAMEQAPV
FLTSFWRFAVCLALLLPFAWAGLRRLSARQWRRQALIGALAYAGYIAPIAKAIELGVS
PGVAALMADLLPLLVALLALVLPGQRTRPGQWPGIALGVAGVLWAGHAALALGRAPGW
AYGLPLLGMLALALATLLQKRWDDAPGSLAVVLFVQIGAALPAFAGLALAEGSLRPPL
SGGFLFGLAWLVLLPTFGGYGLYWLGLRHLSAQGGSAALYLSPALTLLWAHWMFAEPL
TPMLLGGLLLSLAGLGWLYRAERR"
gene complement(900..>903)
/locus_tag="PA1266"
/db_xref="GeneID:881372"
CDS complement(900..>903)
/locus_tag="PA1266"
/note="'Product name confidence: class 3 (Function
proposed based on presence of conserved amino acid motif,
structural feature or limited sequence similarity to an
experimentally studied gene)'"
/codon_start=2
/transl_table=11
/product="oxidoreductase"
/protein_id="NP_249957.1"
/db_xref="GeneID:881372"
/translation="MSADYDLLIVGAGPAGLAAALAAAPSGARIALVDDNPAAGGQIW
RDGPRASLPPRAHQMRQRLAGQANVEHFPATRVVACGPGRRLLLEDPQRGWQVGYRRL
VLCTGARELLLPFPGWTLPGVTGAGGLQALAKGGLPLAGQRLVVAGSGPLLLASAASA
SQCGARLLRVAEQAPARTLAAFAVRLPRWPGKLWQAAGLFARSYRADSYVLAALGEER
LEAVRLREGGRVREIACERLACGFGLVPNVQLGQALGYRLDGPALAVDEWQAGSLPDH
YAAGECTGFGGSELALVEGAIAGHAAVDERDAARRLWPRRRRWQGFADTLARHFALRA
ELRQLAEADTLVCRCEDVPLAALAGHAGWTEAKLHSRCGMGACQGRICGSAAQFLFGW
TPPAPRPPFSPARLETLARWQGDAG"
ORIGIN
1 atgcgcgcga ccacctgcac cccgcgagcg atgcccgggg cgacccgcct gctggccgtg
61 caactgggca tggtactggc ctggagttcc ggcttcgtcg gctaccgcta tgccatggaa
121 caggcgccgg tgttcctcac cagcttctgg cgcttcgccg tttgcctggc gctgctgctg
181 cccttcgcct gggccgggct gcgccggttg tcggcgcgcc agtggcggcg ccaggcgctg
241 atcggggcgt tggcctacgc gggctacatc gcgccgatcg ccaaggccat cgaactcggc
301 gtctcgccgg gcgtggcggc gctgatggcc gacctgttgc cgctgctggt ggccttgctg
361 gcgctggtcc tgccggggca gcgaacgcgg ccggggcagt ggccggggat cgccctgggc
421 gtcgccgggg tgctctgggc cgggcatgcg gcgctggcgc tggggcgggc gccgggctgg
481 gcctacggcc tgccgctgct gggcatgctg gcgctggccc tggccaccct gttgcagaag
541 cgctgggacg atgcgccggg atcgctggcc gtggtgctgt tcgtgcagat cggcgccgcg
601 ctgccggcgt tcgccggcct ggcgctggcg gagggtagcc tgcggccgcc gctgtccggc
661 ggattcctgt tcgggctcgc ctggctggtg ctgctgccca ccttcggcgg ctacggcctg
721 tactggctgg gcctgcgcca tctttccgca cagggtggca gcgcggcgct gtacctgagc
781 ccggcgctga ccctgctatg ggcgcactgg atgttcgccg agccgctgac acccatgctg
841 ctgggtggtc tgctgctgtc gctggccggc ctcggctggc tgtatcgcgc cgagcgtcgc
901 tag
//