Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: M16624.1
FASTA Graphics
LOCUS RATPTRY 821 bp mRNA linear ROD 27-APR-1993 DEFINITION Rat pancreatic cationic trypsinogen mRNA, comlete cds. ACCESSION M16624 VERSION M16624.1 KEYWORDS trypsin; trypsinogen. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 821) AUTHORS Fletcher,T.S., Alhadeff,M., Craik,C.S. and Largman,C. TITLE Isolation and characterization of a cDNA encoding rat cationic trypsinogen JOURNAL Biochemistry 26 (11), 3081-3086 (1987) PUBMED 3607011 COMMENT Original source text: Rat pancreas, cDNA to mRNA. Draft entry and computer-readable copy of sequence [1] kindly provided by T.S.Fletcher, 05-AUG-1987. An activation peptide is located at positions 46 to 70. It contains 5 aspartic acid residues in contrast to the 4 reported for all other trypsinogen activation peptides. FEATURES Location/Qualifiers source 1..821 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" mRNA 1..821 /product="trypsinogen mRNA" CDS 1..744 /note="trypsinogen (EC 3.4.21.4)" /codon_start=1 /protein_id="AAA41985.1" /translation="MKALIFLAFLGAAVALPLDDDDDKIVGGYTCQKNSLPYQVSLNA GYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVVEGGEQFIDAAKIIRHPSYNA NTFDNDIMLIKLNSPATLNSRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQ CLDAPVLSDSSCKSSYPGKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWG YGCAQKGKPGVYTKVCNYVNWIQQTVAAN" sig_peptide 1..45 /note="trypsinogen signal peptide" mat_peptide 70..741 /product="trypsin mature peptide" ORIGIN Unreported. 1 atgaaggcct taattttcct tgctttcctt ggagctgctg ttgctctccc tctggatgat 61 gatgatgaca agattgttgg aggctacacc tgccagaaga attctctccc ataccaggtg 121 tctctgaatg ctggctacca tttttgtgga ggctccctca tcaattccca gtgggttgtt 181 tcagccgctc actgctacaa atcccgaatt caggtgcgcc tgggagaaca caacattgat 241 gtcgttgagg gtggtgagca attcattgat gcagctaaaa tcatccgcca ccccagttat 301 aatgcaaaca cctttgacaa tgatattatg ttgattaagc tgaattcacc tgccaccctc 361 aattctcgag tgtccactgt ctctctgcca agatcttgtg gatcatctgg tactaagtgc 421 cttgtgtctg gctggggcaa caccctgagc tctggcacga actacccttc actgcttcag 481 tgtcttgatg cccctgtcct ctctgacagt tcttgcaaaa gttcttaccc aggcaagatc 541 actagcaaca tgttctgtct gggctttctg gagggcggaa aggactcctg ccagggtgac 601 tctggtggcc ctgtagtctg caatggccag ctccagggtg ttgtttcctg gggttatggc 661 tgtgctcaga aaggaaaacc tggtgtctat accaaggtat gcaactacgt gaactggatt 721 cagcagaccg tcgctgccaa ctaaaacgcc tttatgtctt tatactttgt agtcaaatcc 781 accttctttg tatgccccaa gtcattctca caagaaaaac a //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on