Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: HB835090.1
FASTA Graphics
LOCUS HB835090 993 bp DNA linear PAT 09-SEP-2009 DEFINITION Sequence 184304 from Patent EP2090662. ACCESSION HB835090 VERSION HB835090.1 KEYWORDS . SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 AUTHORS Puzio,P., Blau,A., Walk,T.B., Gipsmans,M., Haake,V., Weig,A., Plesch,G. and Ebneth,M. TITLE Process for the production of a fine chemical JOURNAL Patent: EP 2090662-A2 184304 19-AUG-2009; Metanomics GmbH (DE) FEATURES Location/Qualifiers source 1..993 /organism="Arabidopsis thaliana" /mol_type="unassigned DNA" /db_xref="taxon:3702" CDS 1..993 /note="unnamed protein product" /codon_start=1 /protein_id="CBD31390.1" /translation="MADTSSRTDVSTDGDTDHRDLGSDRGHMHAAASDSSDRSKDKLD QKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQ AHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELF RIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGIN SLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTL EGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE" ORIGIN 1 atggctgata ccagttcaag gactgatgtc tcaactgatg gtgacacaga tcatagagat 61 ctggggtctg atagagggca tatgcatgct gctgcctctg attccagtga tcgatcaaag 121 gataagttgg atcaaaagac ccttcgtagg cttgctcaaa atcgtgaggc agcaagaaaa 181 agcagattga ggaagaaggc gtatgttcag cagctggaga atagtcgatt aaagctgact 241 caacttgagc aggagctgca aagagcaaga cagcagggag ttttcatctc aagttcagga 301 gaccaagctc attctactgg tggcaatggg gctttggcat ttgatgcaga acactcacga 361 tggcttgaag aaaagaacag gcaaatgaac gagctgagat ctgccctgaa tgctcatgca 421 ggtgatactg agctccggat aattgtggat ggagtgatgg ctcactatga ggagcttttc 481 aggattaaga gcaatgcagc taagaatgat gtcttccact tgttatctgg aatgtggaaa 541 acaccagctg agcgatgttt cttgtggctt ggcgggttcc gctcatccga acttctcaag 601 cttcttgcga atcagctaga gcccatgaca gaacgacagg taatgggcat caatagcttg 661 cagcagacgt cgcagcaggc agaagatgct ttatctcaag ggatggagag tttacagcaa 721 tccctagctg atactttatc cagtggaact cttggttcca gttcatcgga taatgtcgcg 781 agctacatgg gtcagatggc catggcaatg gggcagttag gcaccctcga aggattcata 841 cgccaggctg ataacttgag gctgcaaaca ctacaacaga tgcttcgagt attaacaaca 901 cgtcagtcag ctcgtgctct tcttgctata cacgattatt catctcgatt acgtgctctt 961 agttccttgt ggcttgcccg gccaagagag tga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on