Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: HB767906.1
FASTA Graphics
LOCUS HB767906 1071 bp DNA linear PAT 09-SEP-2009 DEFINITION Sequence 117120 from Patent EP2090662. ACCESSION HB767906 VERSION HB767906.1 KEYWORDS . SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 AUTHORS Puzio,P., Blau,A., Walk,T.B., Gipsmans,M., Haake,V., Weig,A., Plesch,G. and Ebneth,M. TITLE Process for the production of a fine chemical JOURNAL Patent: EP 2090662-A2 117120 19-AUG-2009; Metanomics GmbH (DE) FEATURES Location/Qualifiers source 1..1071 /organism="Arabidopsis thaliana" /mol_type="unassigned DNA" /db_xref="taxon:3702" CDS 1..1071 /note="unnamed protein product" /codon_start=1 /protein_id="CBC90368.1" /translation="MGSKDNAISNDSALVLSLLLLLLLPLLHEAAEGCDMFTGRWVKD DSYPLYNSSTCPFIRHEFSCQRNGRPDLDYSTFRWQPLSCKLARFNGLQFLKKNKGKK IMFVGDSLSLNQWQSLACMLHSSVPNSTYTLTTQGSISTYTFKEYGLELKLDRNVYLV DIVREKIGRVLKLDSINDGKNWVEMDTLIFNTWHWWSRRGPAQPWDLIQIGTNVTKDM DRVAAFEIALGTWGKWVDTVLNTKKTRVFFQGISPSHYKGVLWGEPAAKSCVGQKEPL LGTKYPGGLPAEVGVLKRALGKISKPVTLLDITMLSLLRKDAHPSVYGLGGRNSSGDC SHWCLSGVPDTWNEILYNYMVE" ORIGIN 1 atgggttcaa aggataacgc catttctaat gactctgcat tagttttatc gcttcttctt 61 cttcttcttc ttcccctgct tcacgaagca gcagaaggat gtgacatgtt cacggggcgg 121 tgggtgaagg acgattctta ccctctctac aattcctcca cgtgtccgtt cataagacat 181 gagttctctt gccagagaaa tggacggcca gatctcgatt actctacctt cagatggcag 241 cctctttcct gcaaattagc aaggttcaat ggattgcagt ttttgaagaa aaacaaaggg 301 aagaagatta tgtttgttgg tgattctctt agtctaaatc aatggcaatc gttggcatgt 361 atgcttcatt cctctgttcc aaattctacg tatactttaa ccacacaagg tagtatatca 421 acctacacat tcaaggagta tggactggaa ttgaagcttg ataggaatgt ttatctagta 481 gatatagtta gggagaagat tgggagagtt ttgaagcttg attcgatcaa tgatggaaaa 541 aattgggtag agatggatac attgattttt aatacttggc attggtggag tcggagaggt 601 cctgcacaac catgggattt gattcaaata gggactaacg ttacaaaaga catggaccgt 661 gtggccgcgt ttgaaattgc gcttgggact tgggggaaat gggtcgatac cgtcttaaat 721 actaagaaaa ctagagtctt ttttcaagga atttctccat ctcattacaa aggagttctg 781 tggggcgaac cagcggcaaa gagttgcgtg ggacagaagg aaccactttt ggggacaaaa 841 tatccaggag gattgccagc agaagtggga gttttgaaga gagcactcgg gaaaatatcg 901 aaaccggtga cattgctaga cattacgatg ctttcgttgc ttcgcaaaga tgctcatcct 961 tcggtttacg gtctaggcgg gcgaaactcc tccggtgact gcagccactg gtgtctctct 1021 ggggtaccgg atacttggaa tgagattctt tacaattata tggttgagta a //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on