Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: FJ211594.1
FASTA Graphics
LOCUS FJ211594 426 bp mRNA linear ROD 01-OCT-2009 DEFINITION Mus musculus testis specific expressed protein 7 (Tseg7) mRNA, complete cds. ACCESSION FJ211594 VERSION FJ211594.1 KEYWORDS . SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 426) AUTHORS Zheng,L., Zeng,F. and Tong,Q. TITLE Cloning of TSEG-7, a mouse testis specific gene and expression in mouse different developing stages JOURNAL Unpublished REFERENCE 2 (bases 1 to 426) AUTHORS Zheng,L., Zeng,F. and Tong,Q. TITLE Direct Submission JOURNAL Submitted (15-SEP-2008) Department of Surgery, Union Hospital of Tongji Medical College, Huazhong University of Science and Technology, 1277 Jie Fang Avenue, Wuhan, Hubei 430022, P. R. China FEATURES Location/Qualifiers source 1..426 /organism="Mus musculus" /mol_type="mRNA" /strain="BALB/c" /db_xref="taxon:10090" /sex="male" /tissue_type="testis" /dev_stage="adult" gene 1..426 /gene="Tseg7" CDS 1..426 /gene="Tseg7" /codon_start=1 /product="testis specific expressed protein 7" /protein_id="ACO25355.1" /translation="MASEKDDGPALPKLDDDNQTAENTCKPAEEQPQQLRWDDIHLPR FSLKQGMIPTRYVMPWKENMKFRNVNLQQAEACGIYAGPLEDSLFWGYSERLCHGEDR KAVLKKGLPEIKITDMPLHSPLSRYQSTVISHGFRRRLI" ORIGIN 1 atggcttcag aaaaagatga cggtccggcc ttacccaaac tcgacgacga caaccagaca 61 gcagagaaca catgcaaacc tgcagaagag cagcctcaac agctcaggtg ggacgatatt 121 cacttgcccc ggttctcact aaagcaaggg atgatcccga cccgttacgt catgccttgg 181 aaagaaaaca tgaaattcag gaacgtgaat ctacagcaag cagaagcctg tgggatctat 241 gctggccctt tggaagattc tctgttctgg ggttacagcg agaggctttg ccatggggaa 301 gatcggaaag ccgtcctgaa gaaaggcctg ccggagataa agattaccga catgcctttg 361 cattcgcctc tctccagata ccagagcaca gtgatttccc acggtttccg gaggcgactg 421 atctga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on