U.S. flag

An official website of the United States government

Arabidopsis thaliana CAP-gly domain linker (AT1G61450), mRNA

NCBI Reference Sequence: NM_104826.3

FASTA Graphics 

LOCUS       NM_104826                881 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana CAP-gly domain linker (AT1G61450), mRNA.
ACCESSION   NM_104826
VERSION     NM_104826.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 881)
  AUTHORS   Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
            White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
            Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
            Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
            Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
            Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
            Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
            Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
            Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
            Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
            Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
            Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
            Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
            Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
            Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
            Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
            Fraser,C.M., Venter,J.C. and Davis,R.W.
  TITLE     Sequence and analysis of chromosome 1 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 816-820 (2000)
   PUBMED   11130712
REFERENCE   2  (bases 1 to 881)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 881)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 881)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 881)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003070).
            
            On Sep 12, 2016 this sequence version replaced NM_104826.2.
FEATURES             Location/Qualifiers
     source          1..881
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /ecotype="Columbia"
     gene            1..881
                     /locus_tag="AT1G61450"
                     /gene_synonym="T1F9.6; T1F9_6"
                     /db_xref="Araport:AT1G61450"
                     /db_xref="GeneID:842439"
                     /db_xref="TAIR:AT1G61450"
     CDS             331..693
                     /locus_tag="AT1G61450"
                     /gene_synonym="T1F9.6; T1F9_6"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG449750.1,INSD:EG449739.1,INSD:EL153404.1,
                     INSD:EG449737.1,INSD:EG449528.1,INSD:EG449651.1,
                     INSD:EG449525.1,INSD:EG511231.1,INSD:EG449657.1,
                     INSD:EG449752.1,INSD:EG449660.1,INSD:EG449534.1,
                     INSD:EG515376.1,INSD:EG449508.1,INSD:EG515373.1,
                     INSD:EG449658.1,INSD:EG449655.1,INSD:EG449500.1,
                     INSD:EG449654.1"
                     /note="unknown protein; BEST Arabidopsis thaliana protein
                     match is: unknown protein (TAIR:AT1G61415.1); Has 30201
                     Blast hits to 17322 proteins in 780 species: Archae - 12;
                     Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
                     5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="CAP-gly domain linker"
                     /protein_id="NP_176340.2"
                     /db_xref="Araport:AT1G61450"
                     /db_xref="GeneID:842439"
                     /db_xref="TAIR:AT1G61450"
                     /translation="MEDSGAILCQISIFKDMLDQVNREIEANIQVTREIESQIGACSE
                     IESSLSLKEPELTRSFLASQFEISGLISVTADSRNSLKLLEDEICCLRSEHSELITKT
                     NREAGRVCEDVFWIPKRD"
ORIGIN      
        1 caacagtcaa cattggtgtg ccagtgtcac cagagagaag aagacgatca tcaattctac
       61 catttcgaac gcacatattg aaagattaca aacccaactc gaatctgaac cgaaccaaac
      121 tagatccgaa ataaattaaa aagtcggttc gtatttacaa atattgaaag atccgaaatc
      181 cgattgggcc gattttggta aacgcccata aaggcccggt aaaatcttat cttcccctaa
      241 ctcataacga tattgatttt gaattttgaa aagaagcgga agcaagagcg agcgagagag
      301 agagagagac agagagtgat ttctgcggag atggaggatt caggagcgat tctatgtcag
      361 atctccattt tcaaggacat gcttgatcag gtcaatcggg aaatcgaagc aaacattcag
      421 gtgacgcgag agatcgaatc acagatcgga gcgtgttctg agattgaatc ttctctgtct
      481 ctcaaggaac ctgagcttac tagatcgttc cttgcttctc aattcgagat cagcggtttg
      541 atctccgtta cagctgattc aagaaactct ctgaagctat tggaggatga gatttgttgc
      601 ttaagaagtg agcacagtga gctaattaca aagactaacc gagaagcggg aagggtttgt
      661 gaagatgtgt tttggattcc aaagagagat tgaagacagt gaattcagga gtttattggc
      721 tgagaaggag cgtctggaaa acgaagttcg gatgttggaa gagaagaaca tggatgtgaa
      781 gaactctatt ttggcttaca tggaagatga aatgatgaat ctattatctg attagtgttt
      841 ctggaaatat gaaactttta gccattggct tcgaatctaa g
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

More about the AT1G61450 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.