Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AF507083.1
FASTA Graphics
LOCUS AF507083 221 bp DNA linear PRI 24-JUL-2016 DEFINITION Homo sapiens IRCHF7A breast and ovarian cancer susceptibility protein (BRCA2) gene, exon 4 and partial cds. ACCESSION AF507083 VERSION AF507083.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 221) AUTHORS Valarmathi,M.T., Agarwal,A., Deo,S.S.V., Shukla,N.K. and Das,S.N. TITLE BRCA2 germline mutations in Indian breast cancer families JOURNAL Unpublished REFERENCE 2 (bases 1 to 221) AUTHORS Valarmathi,M.T., Agarwal,A. and Das,S.N. TITLE Direct Submission JOURNAL Submitted (30-APR-2002) Department of Biotechnology, All India Institute of Medical Sciences, Ansari Nagar, New Delhi, Delhi 110 029, India FEATURES Location/Qualifiers source 1..221 /organism="Homo sapiens" /mol_type="genomic DNA" /specimen_voucher="IRCHF7A" /db_xref="taxon:9606" /chromosome="13" /map="13q12" /cell_type="lymphocytes" /geo_loc_name="India" gene <1..>221 /gene="BRCA2" variation 7 /gene="BRCA2" /replace="c" mRNA <61..>169 /gene="BRCA2" /product="breast and ovarian cancer susceptibility protein" CDS <61..>169 /gene="BRCA2" /codon_start=3 /product="breast and ovarian cancer susceptibility protein" /protein_id="AAN61430.1" /translation="RNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLSE" exon 61..169 /gene="BRCA2" /number=4 ORIGIN 1 taganggaaa tttataatcc agagtatata cattctcact gaattattgt actgtttcag 61 gaaggaatgt tcccaatagt agacataaaa gtcttcgcac agtgaaaact aaaatggatc 121 aagcagatga tgtttcctgt ccacttctaa attcttgtct tagtgaaagg tatgatgaag 181 ctattatatt aaaatattta aatgaaacat tttcctacat a //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on