U.S. flag

An official website of the United States government

Homo sapiens IRCHF7A breast and ovarian cancer susceptibility protein (BRCA2) gene, exon 4 and partial cds

GenBank: AF507083.1

FASTA Graphics 

LOCUS       AF507083                 221 bp    DNA     linear   PRI 24-JUL-2016
DEFINITION  Homo sapiens IRCHF7A breast and ovarian cancer susceptibility
            protein (BRCA2) gene, exon 4 and partial cds.
ACCESSION   AF507083
VERSION     AF507083.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 221)
  AUTHORS   Valarmathi,M.T., Agarwal,A., Deo,S.S.V., Shukla,N.K. and Das,S.N.
  TITLE     BRCA2 germline mutations in Indian breast cancer families
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 221)
  AUTHORS   Valarmathi,M.T., Agarwal,A. and Das,S.N.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-APR-2002) Department of Biotechnology, All India
            Institute of Medical Sciences, Ansari Nagar, New Delhi, Delhi 110
            029, India
FEATURES             Location/Qualifiers
     source          1..221
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /specimen_voucher="IRCHF7A"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q12"
                     /cell_type="lymphocytes"
                     /geo_loc_name="India"
     gene            <1..>221
                     /gene="BRCA2"
     variation       7
                     /gene="BRCA2"
                     /replace="c"
     mRNA            <61..>169
                     /gene="BRCA2"
                     /product="breast and ovarian cancer susceptibility
                     protein"
     CDS             <61..>169
                     /gene="BRCA2"
                     /codon_start=3
                     /product="breast and ovarian cancer susceptibility
                     protein"
                     /protein_id="AAN61430.1"
                     /translation="RNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLSE"
     exon            61..169
                     /gene="BRCA2"
                     /number=4
ORIGIN      
        1 taganggaaa tttataatcc agagtatata cattctcact gaattattgt actgtttcag
       61 gaaggaatgt tcccaatagt agacataaaa gtcttcgcac agtgaaaact aaaatggatc
      121 aagcagatga tgtttcctgt ccacttctaa attcttgtct tagtgaaagg tatgatgaag
      181 ctattatatt aaaatattta aatgaaacat tttcctacat a
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.