Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AF043583.1
FASTA Graphics
LOCUS AF043583 282 bp mRNA linear PRI 25-JUL-2016 DEFINITION Homo sapiens clone ASMneg1-b3 immunoglobulin lambda chain VJ region, (IGL) mRNA, partial cds. ACCESSION AF043583 VERSION AF043583.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 282) AUTHORS Moyes,S.P. and Mageed,R.A. TITLE Direct Submission JOURNAL Submitted (20-JAN-1998) Clinical Immunology, The Kennedy Institute of Rheumatology, 1 Aspenlea Road, London W7 8TL, UK FEATURES Location/Qualifiers source 1..282 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="ASMneg1-b3" /tissue_type="synovial joint of rheumatoid arthritis patient" /note="Humlv1042" gene <1..282 /gene="IGL" CDS <1..282 /gene="IGL" /note="VJ region" /codon_start=1 /product="immunoglobulin lambda chain" /protein_id="AAC03347.1" /translation="GESVTFSCTGSSSYIGAGYDVHWYRQLPGTAPKLLIYGNTDRPS GVPDRFSGSKSGISASLAITGLQAEDEADYYCKSYDSSLSGVLFGGATN" ORIGIN 1 ggggagagtg tcaccttctc ctgcactggg agcagctcct acatcggggc aggttatgat 61 gtacactggt accggcaact tcccggcaca gcccccaaac tcctcatcta tggtaacacc 121 gatcggccct caggggtccc tgaccgattc tctggctcca agtctggcat ctcagcctcc 181 ctggccatca ctgggctcca ggctgaggat gaggctgatt attactgcaa gtcctatgac 241 agcagcctga gtggtgtcct attcggagga gcgaccaact ga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on