Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_039109371.2
FASTA Graphics
LOCUS XM_039109371 973 bp mRNA linear ROD 22-FEB-2024 DEFINITION PREDICTED: Rattus norvegicus uroporphyrinogen decarboxylase (Urod), transcript variant X1, mRNA. ACCESSION XM_039109371 VERSION XM_039109371.2 DBLINK BioProject: PRJNA1074393 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_086023) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Feb 22, 2024 this sequence version replaced XM_039109371.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_036323735.1-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/09/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..973 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="5" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..973 /gene="Urod" /gene_synonym="porphyrinogen carboxy-lyase" /note="uroporphyrinogen decarboxylase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 37 ESTs, 83 long SRA reads, 1 Protein" /db_xref="GeneID:29421" /db_xref="RGD:3946" CDS 83..901 /gene="Urod" /gene_synonym="porphyrinogen carboxy-lyase" /codon_start=1 /product="uroporphyrinogen decarboxylase isoform X1" /protein_id="XP_038965299.1" /db_xref="GeneID:29421" /db_xref="RGD:3946" /translation="MEVTMVPGKGPSFPEPLREERDLERLRDPAAVASELGYVFQAIT LTRQQLAGRVPLIGFAGAPWTLMTYMVEGGSSSTMAQAKRWLYQKPLASHKLLGILTD ALVPYLIGQVAAGAQALQLFESHAGHLGSELFSKFALPYIRDVAKRVKAGLQKAGLAP VPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARERVGKTVTLQGNLDPCALYAS EEEIGRLVQQMLNDFGPQRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN" polyA_site 973 /gene="Urod" /gene_synonym="porphyrinogen carboxy-lyase" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgctgctat aattttctct gacatccttg ttgtacccca ggttgtgtac ccagatattt 61 tatccccctt aaggcactgg gcatggaggt gaccatggta cctggcaaag gacccagctt 121 tccagagcca ttaagagaag agcgggactt agagcgtcta cgggatccag cagcagtggc 181 ttcagagtta ggctatgtgt tccaagccat cacccttacc cgacaacagc tggctggacg 241 tgtgccactg attggctttg ctggtgctcc gtggaccctg atgacgtaca tggttgaagg 301 cggcagttca agtaccatgg ctcaggccaa gcgatggctc tatcagaagc cactggccag 361 tcacaagctg cttggcatac tcactgatgc tctggtccca tatctaatag gacaagtagc 421 tgctggtgct caggcattgc agctctttga gtcccacgca ggacatcttg gctccgagct 481 cttcagcaag tttgcactgc cttacatccg tgatgtggcc aagcgagtga aggctgggtt 541 gcagaaggcg ggcctggcac cagtgcccat gatcatcttt gccaaggatg gacattttgc 601 cctggaagag ctggcccagg ctggctatga ggtagttgga cttgactgga cagtggctcc 661 aaagaaagcc cgggaacgtg ttggaaagac agtgactctg caggggaacc tggatccctg 721 tgccctgtat gcatctgagg aagagattgg tcgactggtg cagcagatgc tgaatgactt 781 tgggccacag cgctacattg ctaacctagg gcatgggctt taccctgaca tggacccaga 841 acacgtagga gcctttgtgg atgcagtaca caaacactca cgcctgcttc gacagaattg 901 agtatgtgct tttctgctca agtaccaccg acacagattg tttccaggag aataaaactt 961 ccagaaactt cca //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on