Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_011512272.2
FASTA Graphics
LOCUS XM_011512272 837 bp mRNA linear PRI 25-AUG-2024 DEFINITION PREDICTED: Homo sapiens testis expressed 51 (TEX51), transcript variant X5, mRNA. ACCESSION XM_011512272 VERSION XM_011512272.2 DBLINK BioProject: PRJNA168 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000002.12) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Apr 5, 2022 this sequence version replaced XM_011512272.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001405.40-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..837 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" gene 1..837 /gene="TEX51" /note="testis expressed 51; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 long SRA read, and 89% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:101929926" /db_xref="HGNC:HGNC:52387" misc_feature 1 /gene="TEX51" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 30..644 /gene="TEX51" /codon_start=1 /product="testis-expressed protein 51 isoform X5" /protein_id="XP_011510574.1" /db_xref="GeneID:101929926" /db_xref="HGNC:HGNC:52387" /translation="MLPLLIICLLPAIEGKNCLRCWPELSALIDYDLQILWVTPGPPT ELSQSIHSLFLEDNNFLKPWYLDRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYT HKNLFTERLNKISDGLKEKACNESCDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRR TSLWAVSLSSALLLAIAGGGCFFYWQRKKEAVKQEQGSPHVFQK" ORIGIN 1 actggggcac agtaggagga acccagaaga tgctgcctct cctgatcatc tgtctcctgc 61 ctgccattga agggaagaac tgcctccgct gctggccaga actgtctgcc ttgatagact 121 atgacctgca gatcctctgg gtgaccccag ggccacccac agaactttct caaagtattc 181 actccttgtt cctagaggat aataattttc tcaaaccctg gtaccttgat cgtgaccatt 241 tggaagaaga aacagccaaa ttcttcactc aagtacacca agccattaaa acgttacgag 301 atgataaaac agtacttctg gaagagatct acacgcacaa gaatctcttt actgagaggc 361 tgaataagat atctgatggg ctgaaggaga aggcctgcaa tgagtcctgt gacatacagt 421 ccacactgaa ggtcaccagc tgtgctgact gcaggactca cttcctctcc tgcaatgacc 481 ccactttctg cccagccagg aaccggcgga cctccctgtg ggctgtgagt ctcagcagtg 541 ctctactcct ggccatagct ggaggtggat gtttctttta ctggcaaagg aagaaggagg 601 cagtaaagca ggaacagggc agcccgcatg tcttccagaa gtgaacagag gccgcagcta 661 ccaccgtcac aaagttcact catctctggg tcccggtgac cccatccccc cataccctcc 721 atcctgggtc ctggggcccc aaagctctga ggcctaggag actgcgctgt ctcgtggttt 781 gcctactcct acacctttgt aaagagtctc ttcattaaaa cccctcttca tagccta //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on