Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_015115097.2
FASTA Graphics
LOCUS XM_015115097 915 bp mRNA linear PRI 26-APR-2019 DEFINITION PREDICTED: Macaca mulatta olfactory receptor 52A4-like (LOC715677), mRNA. ACCESSION XM_015115097 VERSION XM_015115097.2 DBLINK BioProject: PRJNA528504 KEYWORDS RefSeq; corrected model. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041767.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Apr 23, 2019 this sequence version replaced XM_015115097.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Macaca mulatta Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel internal stop codons :: corrected 1 genomic stop codon ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-777 QNVO02000111.1 55352283-55353059 c 778-778 "N" 1-1 779-915 QNVO02000111.1 55352146-55352282 c FEATURES Location/Qualifiers source 1..915 /organism="Macaca mulatta" /mol_type="mRNA" /isolate="AG07107" /bio_material="Coriell:AG07107" /db_xref="taxon:9544" /chromosome="14" /sex="female" /tissue_type="fibroblast" gene 1..915 /gene="LOC715677" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:715677" CDS 1..915 /gene="LOC715677" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon; substituted 1 base at 1 genomic stop codon" /codon_start=1 /transl_except=(pos:715..717,aa:OTHER) /product="LOW QUALITY PROTEIN: olfactory receptor 52A4-like" /protein_id="XP_014970583.2" /db_xref="GeneID:715677" /translation="MALPITNGTLFMPFVLTFIGIPGLKSVQCWIGIPFCAMYIIALI GNSLVLIIIKSEPSLQEPMYIFLAMLGATDISLSTSIVPKMLGIFWFHLPEIYFDACL FQMWLIHTFQGIESGILLAMALGCSVVICYPLRHAMVFTRQLVTYIVVGVTLQPAILV IPRLLLIKCRLKIYRTKLISHTYCEHMALVKLATEDVYINKFYGILGAFIVGGLDFIF ITLTYIQVFITVFHLPLKEAXLKVFNTCIPHICVFFQFYLLXFFFILYSQIWILYPII GTHHLVQYLPTSPTNPQPLYLWDKDQAH" ORIGIN 1 atggctctgc ctattacaaa tggtaccttg ttcatgcctt ttgtgctgac atttattggg 61 atccctggtt tgaaatctgt acagtgttgg attgggattc cattctgtgc tatgtacatc 121 attgctctga ttggaaattc tctggttttg atcatcatca aatctgagcc aagcctccag 181 gaacccatgt atatcttcct ggccatgcta ggagccacag acatttcact tagcaccagc 241 attgtgccca agatgcttgg tattttttgg ttccatttgc cagagatata ttttgatgct 301 tgcctctttc agatgtggct catccacaca tttcaaggca tcgaatcagg aatcctgcta 361 gccatggctc tgggttgctc tgtagtgatc tgttatcctc tgaggcatgc tatggtattc 421 actcgacagc tagtcactta tattgtagtt ggagtgacat tgcagcctgc cattctggta 481 attccacgtc tattgcttat aaaatgccgt ctgaaaatct accgaaccaa gttaatatcc 541 cacacttact gtgaacacat ggcccttgtg aagcttgcca ctgaggatgt ttacattaat 601 aagttctatg gcatccttgg agcatttatt gttggtgggc ttgacttcat tttcatcacc 661 ctcacctata ttcaagtatt tatcactgtc tttcacttgc ctctgaaaga ggcatgactt 721 aaggtattta atacatgtat tccccatata tgtgtcttct tccaattcta tctccttnac 781 ttttttttca ttttgtactc acagatttgg atcttatatc ctatcatagg tacacatcac 841 cttgtccagt atttacctac tagtcccacc aatcctcaac ccctttatct atgggataaa 901 gaccaagcac attag //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on