U.S. flag

An official website of the United States government

Arabidopsis thaliana ADP glucose pyrophosphorylase large subunit 1 (APL1), mRNA

NCBI Reference Sequence: NM_121927.3

FASTA Graphics 

LOCUS       NM_121927               1732 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana ADP glucose pyrophosphorylase large subunit 1
            (APL1), mRNA.
ACCESSION   NM_121927
VERSION     NM_121927.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1732)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 1732)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1732)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1732)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Apr 18, 2007 this sequence version replaced NM_121927.2.
FEATURES             Location/Qualifiers
     source          1..1732
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..1732
                     /gene="APL1"
                     /locus_tag="AT5G19220"
                     /gene_synonym="ADG2; ADP GLUCOSE PYROPHOSPHORYLASE 2; ADP
                     glucose pyrophosphorylase large subunit 1; ADPG
                     PYROPHOSPHORYLASE; T24G5.120; T24G5_120"
                     /note="Encodes the large subunit of ADP-glucose
                     pyrophosphorylase which catalyzes the first, rate limiting
                     step in starch biosynthesis. The large subunit plays a
                     regulatory role whereas the small subunit (ApS) is the
                     catalytic isoform. Four isoforms (ApL1-4) have been
                     identified. ApL1 is the major large subunit isoform
                     present in leaves. Mutational analysis of APS1 suggests
                     that APL1 and APL2 can compensate for loss of APS1
                     catalytic activity,suggesting both have catalytic as well
                     as regulatory functions."
                     /db_xref="Araport:AT5G19220"
                     /db_xref="GeneID:832042"
                     /db_xref="TAIR:AT5G19220"
     CDS             57..1625
                     /gene="APL1"
                     /locus_tag="AT5G19220"
                     /gene_synonym="ADG2; ADP GLUCOSE PYROPHOSPHORYLASE 2; ADP
                     glucose pyrophosphorylase large subunit 1; ADPG
                     PYROPHOSPHORYLASE; T24G5.120; T24G5_120"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR262683.1,INSD:EH916153.1,INSD:EH874937.1,
                     INSD:BP628767.1,INSD:EL140140.1,INSD:EL208883.1,
                     INSD:BP634233.1,INSD:EL157521.1,INSD:BP649330.1,
                     INSD:EL214553.1,INSD:EL011110.1,INSD:EL023917.1,
                     INSD:BP642503.1,INSD:EL122225.1,INSD:EL257096.1,
                     INSD:AV799043.1,INSD:EL173708.1,INSD:AV805461.1,
                     INSD:EH813966.1,INSD:EH796917.1,INSD:EG515934.1,
                     INSD:EL060566.1,INSD:CB262918.1,INSD:EH892354.1,
                     INSD:EL263780.1,INSD:EH970876.1,INSD:EL244845.1,
                     INSD:EH950456.1,INSD:EL128937.1,INSD:EH932806.1,
                     INSD:BP780502.1,INSD:EH974515.1,INSD:EL290692.1,
                     INSD:EH971060.1,INSD:AV814462.1,INSD:EL008377.1,
                     INSD:EH884484.1,INSD:EL247288.1,INSD:CA781572.1,
                     INSD:EL054609.1,INSD:BP784782.1,INSD:EL095246.1,
                     INSD:EL228852.1,INSD:EL183032.1,INSD:AV519982.1,
                     INSD:EL245856.1,INSD:AI997484.1,INSD:EL149934.1,
                     INSD:EH895670.1,INSD:EL199293.1,INSD:AU227915.1,
                     INSD:EL169884.1,INSD:EH893976.1,INSD:EL038256.1,
                     INSD:AV827704.1,INSD:EL246825.1,INSD:EL322014.1,
                     INSD:BP785764.1,INSD:EH850713.1,INSD:BP839211.1,
                     INSD:BP796154.1,INSD:EL161893.1,INSD:EL288515.1,
                     INSD:DR262682.1,INSD:EL113875.1,INSD:BP779272.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:X73367.2,INSD:U72290.1,INSD:AF370503.1,
                     INSD:BT008884.1"
                     /note="ADP glucose pyrophosphorylase large subunit 1
                     (APL1); FUNCTIONS IN: glucose-1-phosphate
                     adenylyltransferase activity; INVOLVED IN: cellulose
                     biosynthetic process, biosynthetic process, glycogen
                     biosynthetic process; LOCATED IN: chloroplast, chloroplast
                     stroma, chloroplast envelope; EXPRESSED IN: 26 plant
                     structures; EXPRESSED DURING: 14 growth stages; CONTAINS
                     InterPro DOMAIN/s: Glucose-1-phosphate adenylyltransferase
                     (InterPro:IPR011831), ADP-glucose pyrophosphorylase,
                     conserved site (InterPro:IPR005836), Nucleotidyl
                     transferase (InterPro:IPR005835); BEST Arabidopsis
                     thaliana protein match is: ADPGLC-PPase large subunit
                     (TAIR:AT1G27680.1); Has 1807 Blast hits to 1807 proteins
                     in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736;
                     Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes -
                     339 (source: NCBI BLink)."
                     /codon_start=1
                     /product="ADP glucose pyrophosphorylase large subunit 1"
                     /protein_id="NP_197423.1"
                     /db_xref="GeneID:832042"
                     /db_xref="TAIR:AT5G19220"
                     /db_xref="Araport:AT5G19220"
                     /translation="MVVSADCRISLSAPSCIRSSSTGLTRHIKLGSFCNGELMGKKLN
                     LSQLPNIRLRSSTNFSQKRILMSLNSVAGESKVQELETEKRDPRTVASIILGGGAGTR
                     LFPLTKRRAKPAVPIGGAYRLIDVPMSNCINSGINKVYILTQYNSASLNRHLARAYNS
                     NGLGFGDGYVEVLAATQTPGESGKRWFQGTADAVRQFHWLFEDARSKDIEDVLILSGD
                     HLYRMDYMDFIQDHRQSGADISISCIPIDDRRASDFGLMKIDDKGRVISFSEKPKGDD
                     LKAMAVDTTILGLSKEEAEKKPYIASMGVYVFKKEILLNLLRWRFPTANDFGSEIIPF
                     SAKEFYVNAYLFNDYWEDIGTIRSFFEANLALTEHPGAFSFYDAAKPIYTSRRNLPPS
                     KIDNSKLIDSIISHGSFLTNCLIEHSIVGIRSRVGSNVQLKDTVMLGADYYETEAEVA
                     ALLAEGNVPIGIGENTKIQECIIDKNARVGKNVIIANSEGIQEADRSSDGFYIRSGIT
                     VILKNSVIKDGVVI"
ORIGIN      
        1 tctcttttat cttcccctct cttcaaaccc ttcaagagac aatctttcct gcgaaaatgg
       61 tggtctctgc tgactgcaga atctccctct ctgcccctag ctgcatacgt agtagctcca
      121 cgggattgac taggcacatt aagcttggca gcttctgcaa tggtgagctc atggggaaga
      181 agctcaactt gtctcagctt ccaaacattc gtcttcgatc ttctactaac ttctctcaga
      241 agagaatttt aatgtctcta aatagtgtag ctggggagag taaggtacaa gaacttgaga
      301 ctgagaaaag ggatccaagg acagttgctt ccattattct tggaggtgga gcaggaactc
      361 gactctttcc tctcacaaaa cgccgcgcca agcctgccgt tcctatcggg ggagcctata
      421 ggttgataga tgtaccaatg agcaattgta ttaacagcgg aatcaacaaa gtctacatac
      481 tcacacaata taactcagca tcattgaaca ggcatttagc ccgtgcttac aactccaatg
      541 gacttggctt tggagatggc tatgttgagg ttcttgcggc cactcaaacg ccaggagaat
      601 ctggtaaaag gtggttccaa ggtacagcag atgcggttcg gcaattccat tggcttttcg
      661 aggatgcaag aagcaaggac atagaggatg tattgatcct ttctggagat cacctctaca
      721 ggatggatta catggatttt atacaggatc atcggcagag tggcgcggat ataagcattt
      781 cctgcatacc aatagatgac agacgtgcct cagattttgg gcttatgaag atagatgaca
      841 aaggaagagt tatctcattc agtgaaaaac ctaaaggaga cgacctgaaa gcaatggcag
      901 tagacacaac tattttagga ctttccaagg aggaagctga aaagaaacca tacatagctt
      961 caatgggagt ttatgttttc aaaaaagaaa tactgttaaa tctcttgaga tggcgtttcc
     1021 ccacagcaaa cgactttggt tcagagatta tacccttctc agctaaagaa ttctatgtga
     1081 atgcttatct ctttaatgac tactgggaag atataggaac aataagatct ttcttcgagg
     1141 cgaatcttgc actcactgag catcctgggg catttagttt ctacgacgcg gcaaaaccaa
     1201 tatatacatc aaggagaaac ctgccaccat caaaaataga caactctaag ctcatcgatt
     1261 caatcatttc tcatggaagc ttcttaacca actgcttgat tgagcatagc attgtgggaa
     1321 ttagatcaag agtaggcagt aatgttcagt tgaaggacac tgtgatgctt ggggcagatt
     1381 actacgaaac tgaagcagaa gttgcagcac tacttgctga gggaaacgtt cccattggaa
     1441 taggagagaa cacaaaaatt caagaatgca taatagacaa gaatgctaga gttggaaaga
     1501 atgtaatcat cgcaaactcg gagggaatac aagaagcaga taggtcatcc gatggatttt
     1561 acatcagatc tggcattact gtaatcttga agaactcagt aattaaagat ggagttgtga
     1621 tatgatactt ttaagatcta attgtaagaa ctgagaacta aaaaatgcag agcataaaag
     1681 tcaacaataa attacaaaga aatttatttg atagtgatga cacttcacat at
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for ADP glucose pyrophosphorylase large subunit 1 (NP_197423.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.