Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: CM007644.1
FASTA Graphics
LOCUS CM007644 62475 bp DNA circular CON 25-JAN-2017 DEFINITION Zancudomyces culisetae strain COL-18-3 mitochondrion, complete sequence, whole genome shotgun sequence. ACCESSION CM007644 LSSK01000000 VERSION CM007644.1 DBLINK BioProject: PRJNA311769 BioSample: SAMN04488584 KEYWORDS WGS. SOURCE mitochondrion Zancudomyces culisetae ORGANISM Zancudomyces culisetae Eukaryota; Fungi; Fungi incertae sedis; Zoopagomycota; Kickxellomycotina; Harpellomycetes; Harpellales; Legeriomycetaceae; Zancudomyces. REFERENCE 1 (bases 1 to 62475) AUTHORS Wang,Y., White,M., Kvist,S. and Moncalvo,J.-M. TITLE Direct Submission JOURNAL Submitted (13-JAN-2017) Ecology and Evolutionary Biology, University of Toronto, 100 Qween's Park, Toronto, ON M5S 2C6, Canada COMMENT ##Genome-Assembly-Data-START## Assembly Method :: Ray v. 2.3.1 Genome Coverage :: 26.0x Sequencing Technology :: Illumina HiSeq ##Genome-Assembly-Data-END## FEATURES Location/Qualifiers source 1..62475 /organism="Zancudomyces culisetae" /organelle="mitochondrion" /mol_type="genomic DNA" /strain="COL-18-3" /isolation_source="stagnant pool next to stream draining" /host="Culiseta impatiens" /type_material="type material of Smittium culisetae" /db_xref="taxon:1213189" /geo_loc_name="USA: Colorado" /collection_date="Aug-1963" gene 45186..45754 /locus_tag="AX774_g7614" mRNA join(45365..45449,45498..45522,45577..45667) /locus_tag="AX774_g7614" /product="cytochrome c oxidase subunit 1" CDS join(45365..45449,45498..45522,45577..45667) /locus_tag="AX774_g7614" /codon_start=1 /transl_table=4 /product="cytochrome c oxidase subunit 1" /protein_id="OMH78983.1" /translation="MPRRIPDYADAYTGWNVISSYGSLISVFKNPISSDYCSYGLEWT IASPTPLHYLYELPKVTNNINN" CONTIG join(LSSK01001705.1:1..62475) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on