NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1720390524|ref|XP_030105747|]
View 

olfactory receptor 118 isoform X1 [Mus musculus]

Protein Classification

G protein-coupled receptor family protein( domain architecture ID 705710)

G protein-coupled receptor family protein is a seven-transmembrane G protein-coupled receptor (7TM-GPCR) family protein which typically transmits an extracellular signal into the cell by the conformational rearrangement of the 7TM helices and by the subsequent binding and activation of an intracellular heterotrimeric G protein; GPCR ligands include light-sensitive compounds, odors, pheromones, hormones, and neurotransmitters

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
31-167 3.30e-46

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15225:

Pssm-ID: 475119  Cd Length: 277  Bit Score: 152.61  E-value: 3.30e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQMFFF 110
Cdd:cd15225     1 LLLFVVFLLIYLVTLLGNLLIILITKVDPALHTPMYFFLRNLSFLEICYTSVIVPKMLVNLLSEDKTISFLGCATQMFFF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 111 IFF----------------------------------------------------------------------------- 113
Cdd:cd15225    81 LFLggtecfllaamaydryvaicnplrytlimnrrvclqlvagswlsgilvslgqttlifslpfcgsneinhffcdippv 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 114 ---------------------------------------------------------------VTLFFGSGSITYLRPKS 130
Cdd:cd15225   161 lklacadtslneiaifvasvlvilvpfllilvsyifiistilkipsaegrrkafstcsshlivVTLFYGCASFTYLRPKS 240
                         250       260       270
                  ....*....|....*....|....*....|....*..
gi 1720390524 131 SHLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAAL 167
Cdd:cd15225   241 SYSPETDKLLSLFYTVVTPMLNPIIYSLRNKEVKGAL 277
 
Name Accession Description Interval E-value
7tmA_OR10A-like cd15225
olfactory receptor subfamily 10A and related proteins, member of the class A family of ...
31-167 3.30e-46

olfactory receptor subfamily 10A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10A, 10C, 10H, 10J, 10V, 10R, 10J, 10W, among others, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320353  Cd Length: 277  Bit Score: 152.61  E-value: 3.30e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQMFFF 110
Cdd:cd15225     1 LLLFVVFLLIYLVTLLGNLLIILITKVDPALHTPMYFFLRNLSFLEICYTSVIVPKMLVNLLSEDKTISFLGCATQMFFF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 111 IFF----------------------------------------------------------------------------- 113
Cdd:cd15225    81 LFLggtecfllaamaydryvaicnplrytlimnrrvclqlvagswlsgilvslgqttlifslpfcgsneinhffcdippv 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 114 ---------------------------------------------------------------VTLFFGSGSITYLRPKS 130
Cdd:cd15225   161 lklacadtslneiaifvasvlvilvpfllilvsyifiistilkipsaegrrkafstcsshlivVTLFYGCASFTYLRPKS 240
                         250       260       270
                  ....*....|....*....|....*....|....*..
gi 1720390524 131 SHLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAAL 167
Cdd:cd15225   241 SYSPETDKLLSLFYTVVTPMLNPIIYSLRNKEVKGAL 277
7tm_4 pfam13853
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
39-107 1.13e-10

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


Pssm-ID: 404695  Cd Length: 278  Bit Score: 58.67  E-value: 1.13e-10
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  39 LMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:pfam13853   3 LMYLIIFLGNGTILFVIKTESSLHQPMYLFLAMLALIDLGLSASTLPTVLGIFWFGLREISFEACLTQM 71
 
Name Accession Description Interval E-value
7tmA_OR10A-like cd15225
olfactory receptor subfamily 10A and related proteins, member of the class A family of ...
31-167 3.30e-46

olfactory receptor subfamily 10A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10A, 10C, 10H, 10J, 10V, 10R, 10J, 10W, among others, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320353  Cd Length: 277  Bit Score: 152.61  E-value: 3.30e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQMFFF 110
Cdd:cd15225     1 LLLFVVFLLIYLVTLLGNLLIILITKVDPALHTPMYFFLRNLSFLEICYTSVIVPKMLVNLLSEDKTISFLGCATQMFFF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 111 IFF----------------------------------------------------------------------------- 113
Cdd:cd15225    81 LFLggtecfllaamaydryvaicnplrytlimnrrvclqlvagswlsgilvslgqttlifslpfcgsneinhffcdippv 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 114 ---------------------------------------------------------------VTLFFGSGSITYLRPKS 130
Cdd:cd15225   161 lklacadtslneiaifvasvlvilvpfllilvsyifiistilkipsaegrrkafstcsshlivVTLFYGCASFTYLRPKS 240
                         250       260       270
                  ....*....|....*....|....*....|....*..
gi 1720390524 131 SHLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAAL 167
Cdd:cd15225   241 SYSPETDKLLSLFYTVVTPMLNPIIYSLRNKEVKGAL 277
7tmA_OR cd13954
olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled ...
31-107 7.96e-32

olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320092 [Multi-domain]  Cd Length: 270  Bit Score: 115.27  E-value: 7.96e-32
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd13954     1 ILLFVLFLLIYLLTLLGNLLIILLVRLDSRLHTPMYFFLSNLSFLDICYTSVTVPKMLANLLSGDKTISFSGCLTQL 77
7tmA_OR6C-like cd15912
olfactory receptor subfamily 6C and related proteins, member of the class A family of ...
31-107 6.58e-29

olfactory receptor subfamily 6C and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6C, 6X, 6J, 6T, 6V, 6M, 9A, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320578  Cd Length: 270  Bit Score: 107.57  E-value: 6.58e-29
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15912     1 ILLFLLLLLTYLLTLLGNLLIITITLVDHRLHTPMYFFLRNFSFLEILFTSVVIPKMLANLLSGKKTISFAGCFAQS 77
7tmA_OR1A-like cd15235
olfactory receptor subfamily 1A and related proteins, member of the class A family of ...
32-107 1.37e-28

olfactory receptor subfamily 1A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 1A, 1B, 1K, 1L, 1Q and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320363 [Multi-domain]  Cd Length: 278  Bit Score: 106.92  E-value: 1.37e-28
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15235     3 LLFLLFLAMYLLTLLGNLLIVLLIRSDPRLHTPMYFFLSHLSLVDICFTSTTVPKMLANLLSGSKTISYAGCLAQM 78
7tmA_OR2T-like cd15421
olfactory receptor subfamily 2T and related proteins, member of the class A family of ...
32-167 1.86e-28

olfactory receptor subfamily 2T and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamilies 2T, 2M, 2L, 2V, 2Z, 2AE, 2AG, 2AK, 2AJ, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320543  Cd Length: 277  Bit Score: 106.48  E-value: 1.86e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQMFFFI 111
Cdd:cd15421     2 FLFSLILLIFLVALTGNALLILLIWLDSRLHTPMYFLLSQLSLMDLMLISTTVPKMATNFLSGRKSISFVGCGTQIFFFL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 112 FFV----------------------------------------------------------------------------- 114
Cdd:cd15421    82 TLGgaeclllalmaydryvaichplrypvlmsprvcllmaagswlggslnslihtvytmhfpycgsreihhffcevpall 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 115 ---------------------------------------------------------------TLFFGSGSITYLRPKSS 131
Cdd:cd15421   162 klscadtsayetvvyvsgvlfllipfslilasyalilltvlrmrsaegrkkalatcsshltvvSLYYGPAIFTYMRPGSY 241
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 1720390524 132 HLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAAL 167
Cdd:cd15421   242 HSPEQDKVVSVFYTILTPMLNPLIYSLRNKEVLGAL 277
7tmA_OR13-like cd15232
olfactory receptor family 13 and related proteins, member of the class A family of ...
32-107 2.78e-27

olfactory receptor family 13 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 13 (subfamilies 13A1 and 13G1) and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320360 [Multi-domain]  Cd Length: 270  Bit Score: 103.49  E-value: 2.78e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15232     2 LLFWLFLFLYAAALTGNSLIILAISTSPKLHTPMYFFLVNLSLVDIICTSTVVPKLLQNLLTERKTISFGGCMAQL 77
7tmA_OR1_7-like cd15918
olfactory receptor families 1, 7, and related proteins, member of the class A family of ...
32-107 1.57e-26

olfactory receptor families 1, 7, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 1 and 7, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320584 [Multi-domain]  Cd Length: 270  Bit Score: 101.54  E-value: 1.57e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15918     2 LLFGLFLGMYLVTVLGNLLIILAIGSDSHLHTPMYFFLANLSLVDICFTSTTVPKMLVNIQTQSKSISYAGCLTQM 77
7tmA_OR11A-like cd15911
olfactory receptor subfamily 11A and related proteins, member of the class A family of ...
31-106 4.08e-26

olfactory receptor subfamily 11A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 11A and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320577  Cd Length: 270  Bit Score: 100.25  E-value: 4.08e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQ 106
Cdd:cd15911     1 ILLFLLFLVIYIVTMAGNILIIVLVVADRHLHTPMYFFLGNLSCLEICYTSTILPRMLASLLTGDRTISVSGCIVQ 76
7tmA_OR2-like cd15237
olfactory receptor family 2 and related proteins, member of the class A family of ...
32-107 5.75e-26

olfactory receptor family 2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 2 and 13, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320365 [Multi-domain]  Cd Length: 270  Bit Score: 100.04  E-value: 5.75e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15237     2 LLFILFLLIYLLTLLGNGLIILLIWLDSRLHTPMYFFLSNLSLLDICYTTSTVPQMLVHLLSEHKTISFVGCAAQM 77
7tmA_OR5V1-like cd15231
olfactory receptor subfamily 5V1 and related proteins, member of the class A family of ...
31-107 1.63e-25

olfactory receptor subfamily 5V1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5V1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320359 [Multi-domain]  Cd Length: 277  Bit Score: 98.88  E-value: 1.63e-25
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15231     1 LLLFLIFLIIYLVTLLGNLLIITLVLLDSHLHTPMYFFLSNLSFLDICYTSVTVPKMLVNLLRERKTISYIGCLAQL 77
7tmA_OR5-like cd15230
olfactory receptor family 5 and related proteins, member of the class A family of ...
32-107 1.01e-24

olfactory receptor family 5 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 5, some subfamilies from families 8 and 9, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320358  Cd Length: 270  Bit Score: 96.81  E-value: 1.01e-24
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15230     2 PLFVLFLLIYLITLVGNLGMIVLIRIDSRLHTPMYFFLSNLSFVDICYSSVITPKMLVNFLSEKKTISFAGCAAQF 77
7tmA_OR5AP2-like cd15943
olfactory receptor subfamily 5AP2 and related proteins, member of the class A family of ...
18-171 1.89e-24

olfactory receptor subfamily 5AP2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AP2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320609 [Multi-domain]  Cd Length: 295  Bit Score: 96.66  E-value: 1.89e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  18 FAFAKFSEVPEECFLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRG 97
Cdd:cd15943     2 FILLGLTDNPELQVILFAVFLVIYLITLVGNLGMIVLIRLDSRLHTPMYFFLSHLSFLDLCYSSAITPKMLVNFLAENKT 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  98 ISREGCATQMFFFIFF----------------------------------VTLFFGS----------------------- 120
Cdd:cd15943    82 ISFTGCAAQMYFFVAFattecfllavmaydryvaicnpllytvimsprvcIQLVAGSyligfvnaliqtictfrlpfcgs 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524     --------------------------------------------------------------------------------
Cdd:cd15943   162 nvinhffcdvppllklscsdthvneivlfafaiflgiftsleilvsyvyilsailrihssegrrkafstcashlmavtif 241
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....
gi 1720390524 121 -GSIT--YLRPKSSHLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRKTL 171
Cdd:cd15943   242 yGTTLfmYLRPSSSYSLDQDKVVSVFYTVVIPMLNPLIYSLRNKEVKDALRRIL 295
7tmA_OR8S1-like cd15229
olfactory receptor subfamily 8S1 and related proteins, member of the class A family of ...
31-167 7.79e-24

olfactory receptor subfamily 8S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 8S1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320357 [Multi-domain]  Cd Length: 277  Bit Score: 94.59  E-value: 7.79e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQMFFF 110
Cdd:cd15229     1 IFLFLVFLVIYLLTLLGNLLIMLVIRADSHLHTPMYFFLSHLSFLDICYSSVTVPKMLENLLSERKTISVEGCIAQIFFF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 111 IFFV---------------------------------------------------------------------------- 114
Cdd:cd15229    81 FFFAgteafllsamaydryaaichplhyvqimskqvcvqlvggawalgflyalintllllnlhfcgpneinhfscelpsl 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 115 ----------------------------------------------------------------TLFFGSGSITYLRPKS 130
Cdd:cd15229   161 lplscsdtfankmvlltssvifglgsflltlvsyihiistilrirsaegrskafstcsshltvvGLFYGTGFFRYLRPNS 240
                         250       260       270
                  ....*....|....*....|....*....|....*..
gi 1720390524 131 SHLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAAL 167
Cdd:cd15229   241 ASSSVLDRVFSIQYSILTPMLNPIIYSLKNKEVKAAL 277
7tmA_OR7-like cd15234
olfactory receptor family 7 and related proteins, member of the class A family of ...
32-107 9.95e-24

olfactory receptor family 7 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 7 and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320362 [Multi-domain]  Cd Length: 277  Bit Score: 94.18  E-value: 9.95e-24
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15234     2 LLFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMYFFLSNLSFADICFSSTTVPKMLVNIQTQSKSISYTGCLTQM 77
7tmA_OR5A1-like cd15417
olfactory receptor subfamily 5A1 and related proteins, member of the class A family of ...
32-169 1.73e-23

olfactory receptor subfamily 5A1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5A1, 5A2, 5AN1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320539  Cd Length: 279  Bit Score: 93.48  E-value: 1.73e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  32 LLFTLILLMFLVSLTGN-ALITLaICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQMFFF 110
Cdd:cd15417     2 ILFVLFLGIYLVTLLWNlGLIIL-IRMDSHLHTPMYFFLSNLSFVDICYSSSITPKMLSDFFREQKTISFVGCATQYFVF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 111 IFFVTL-------------------------------------------------------------------------- 116
Cdd:cd15417    81 SGMGLTecfllaamaydryvaicnpllysvimsprlcvqlvagaylggflnsliqtvsmfqlsfcgpnvidhffcdippl 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 117 ------------------------------------------------------------------FFGSGSITYLRPKS 130
Cdd:cd15417   161 lslscsdtfisqvvlflvavlfgvfsvlvvlisygyiistilkirsakgrskafntcashltavtlFYGTGLFVYLRPSS 240
                         250       260       270
                  ....*....|....*....|....*....|....*....
gi 1720390524 131 SHLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRK 169
Cdd:cd15417   241 SHSQDQDKVASVFYTVVIPMLNPLIYSLRNKEIKDALKR 279
7tmA_OR5D-like cd15410
olfactory receptor subfamily 5D and related proteins, member of the class A family of ...
18-107 1.03e-22

olfactory receptor subfamily 5D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5D, 5L, 5W, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320532  Cd Length: 294  Bit Score: 91.95  E-value: 1.03e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  18 FAFAKFSEVPEECFLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRG 97
Cdd:cd15410     1 FILLGFTDYPELQVPLFLVFLAIYGITLLGNLGMIVLIKIDPKLHTPMYFFLSHLSFVDFCYSSVIAPKMLVNFLAEDKA 80
                          90
                  ....*....|
gi 1720390524  98 ISREGCATQM 107
Cdd:cd15410    81 ISYSGCMLQF 90
7tmA_OR5AK3-like cd15408
olfactory receptor subfamily 5AK3, 5AU1, and related proteins, member of the class A family of ...
18-107 1.26e-22

olfactory receptor subfamily 5AK3, 5AU1, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AK3, 5AU1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320530  Cd Length: 287  Bit Score: 91.61  E-value: 1.26e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  18 FAFAKFSEVPEECFLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRG 97
Cdd:cd15408     1 FILLGFTDQPELQVLLFVVFLLIYVITLVGNLGMILLIRLDSRLHTPMYFFLSHLSFLDICYSSTITPKTLLNLLAERKV 80
                          90
                  ....*....|
gi 1720390524  98 ISREGCATQM 107
Cdd:cd15408    81 ISFTGCLTQL 90
7tmA_OR2F-like cd15429
olfactory receptor subfamily 2F and related proteins, member of the class A family of ...
33-167 1.88e-22

olfactory receptor subfamily 2F and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2F and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320546 [Multi-domain]  Cd Length: 277  Bit Score: 90.92  E-value: 1.88e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQMFFF-- 110
Cdd:cd15429     3 LFVLFLVMYLLTLLGNFLIILLIRLDPRLHTPMYFFLSHLSFLDICYTTSVVPQMLAHFLAEHKTISFASCVAQLFISla 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 111 -----------------------------------IFFVTLFFGSGSI-------------------------------- 123
Cdd:cd15429    83 lggtefillavmaydryvavchplrytvimsgglcIQLAAASWTSGFLnslvqtaftfrlpfcghntinhfscellavvr 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 124 -----------------------------------------------------------------------TYLRPKSSH 132
Cdd:cd15429   163 lacvdtslnevailvssvvvlltpcflvllsyihiisailrirssegrhkafstcashltvvslcygtaifTYMRPRSGS 242
                         250       260       270
                  ....*....|....*....|....*....|....*
gi 1720390524 133 LPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAAL 167
Cdd:cd15429   243 SALQEKMISLFYAVVTPMLNPLIYSLRNKEVKGAL 277
7tmA_OR6N-like cd15914
olfactory receptor OR6N and related proteins, member of the class A family of ...
32-107 2.46e-22

olfactory receptor OR6N and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6N, 6K, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320580 [Multi-domain]  Cd Length: 270  Bit Score: 90.51  E-value: 2.46e-22
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15914     2 LLFILLLLIYLFIITGNLLIFTVVRLDTHLHTPMYFFISILSFLEIWYTTVTIPKMLSNLLSEEKTISFNGCLLQM 77
7tmA_OR8H-like cd15411
olfactory receptor subfamily 8H and related proteins, member of the class A family of ...
33-169 2.48e-22

olfactory receptor subfamily 8H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8H, 8I, 5F and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320533 [Multi-domain]  Cd Length: 279  Bit Score: 90.45  E-value: 2.48e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGC--------- 103
Cdd:cd15411     3 LFVLFLVIYVITVMGNLGMILLIRADSQLHTPMYFFLSNLSFVDFCYSSTITPKALENFLSGRKAISFAGCfvqmyffia 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524     --------------------------------------------------------------------------------
Cdd:cd15411    83 lattecfllglmaydryvaicnpllytvvmsrrvclklaagsyaagflnslihttlisrlsfcgsnvinhffcdtppllk 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 104 -------ATQMFFFIFFVTLFFGS--------------------------------------------GSITYLRPKSSH 132
Cdd:cd15411   163 lscsdthVNEMLIFILAGLTLVGSlliilvsytyilstilkirsaegrrkafstcashltavtifygtGIFTYLRPSSSY 242
                         250       260       270
                  ....*....|....*....|....*....|....*..
gi 1720390524 133 LPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRK 169
Cdd:cd15411   243 SLGQDKVASVFYTVVIPMLNPLIYSLRNKEVKNALRR 279
7tmA_OR13-like cd15430
olfactory receptor family 13 and related proteins, member of the class A family of ...
31-107 3.23e-22

olfactory receptor family 13 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 13 (subfamilies 13C, 13D, 13F, and 13J), some subfamilies from OR family 2 (2K and 2S), and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320547 [Multi-domain]  Cd Length: 270  Bit Score: 90.12  E-value: 3.23e-22
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15430     1 ILLFVLCLIMYLVILLGNGVLIIITILDSHLHTPMYFFLGNLSFLDICYTSSSVPLMLVNFLSERKTISFSGCAVQM 77
7tmA_OR13H-like cd15431
olfactory receptor subfamily 13H and related proteins, member of the class A family of ...
32-107 6.78e-22

olfactory receptor subfamily 13H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 13H and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320548 [Multi-domain]  Cd Length: 269  Bit Score: 89.21  E-value: 6.78e-22
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15431     2 ILFVLLLIVYLVTLLGNGLIILLIRVDSQLHTPMYFFLSNLSFLDICYTTSSVPQMLVNCLSDRPTISYSRCLAQM 77
7tmA_OR2A-like cd15420
olfactory receptor subfamily 2A and related proteins, member of the class A family of ...
31-107 8.58e-22

olfactory receptor subfamily 2A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2A and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320542 [Multi-domain]  Cd Length: 277  Bit Score: 88.92  E-value: 8.58e-22
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15420     1 LLLFGLFSLLYIFTLLGNGLILGLIWLDSRLHTPMYFFLSHLAVVDICYASSTVPHMLGNLLKQRKTISFAGCGTQM 77
7tmA_OR4A-like cd15939
olfactory receptor 4A and related proteins, member of the class A family of ...
30-107 2.31e-21

olfactory receptor 4A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4A, 4C, 4P, 4S, 4X and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320605 [Multi-domain]  Cd Length: 267  Bit Score: 87.65  E-value: 2.31e-21
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720390524  30 CFLLFtliLLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15939     3 CFVVF---LLIYLATVLGNLLIVVTIKASQTLGSPMYFFLSYLSFIDICYSSTTAPKLIVDLLSERKTISFNGCMTQL 77
7tmA_OR6B-like cd15224
olfactory receptor subfamily 6B and related proteins, member of the class A family of ...
32-107 4.84e-21

olfactory receptor subfamily 6B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6B, 6A, 6Y, 6P, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320352  Cd Length: 270  Bit Score: 86.95  E-value: 4.84e-21
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15224     2 LLFLLFLIAYVLTLLENLLIILTIWLNSQLHKPMYFFLSNLSFLEIWYISVTVPKLLAGFLSQNKSISFVGCMTQL 77
7tmA_OR14-like cd15227
olfactory receptor family 14 and related proteins, member of the class A family of ...
32-107 9.95e-21

olfactory receptor family 14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 14 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320355  Cd Length: 270  Bit Score: 85.97  E-value: 9.95e-21
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15227     2 LHFVLFLLIYLAALTGNLLIITVVTLDHHLHTPMYFFLKNLSFLDLCYISVTVPKSIANSLTNTRSISFLGCVAQV 77
7tmA_OR9K2-like cd15419
olfactory receptor subfamily 9K2 and related proteins, member of the class A family of ...
32-169 1.35e-20

olfactory receptor subfamily 9K2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes transmembrane olfactory receptor subfamily 9K2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320541  Cd Length: 279  Bit Score: 85.82  E-value: 1.35e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM---- 107
Cdd:cd15419     2 LLFLLFLVIYMVTVLGNIGMIIIISTDSRLHTPMYFFLMNLSFLDLCYSSVIAPKALANFLSESKTISYNGCAAQFfffs 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524     --------------------------------------------------------------------------------
Cdd:cd15419    82 lfgttegfllaamaydrfiaicnpllypvimsrrvcvqlvagsylcgcinsiiqtsftfslsfcgsneidhffcdvppll 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 108 --------------------------------------------------------FFFIFFVTLFFGSGSITYLRPKSS 131
Cdd:cd15419   162 klscsdtfinelvmfvlcgliivstilvilvsyayilstilripsaegrkkafstcASHLTAVSLFYGTVFFMYAQPGAV 241
                         250       260       270
                  ....*....|....*....|....*....|....*...
gi 1720390524 132 HLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRK 169
Cdd:cd15419   242 SSPEQSKVVSVFYTLVIPMLNPLIYSLRNKDVKEALKR 279
7tmA_OR5M-like cd15412
olfactory receptor subfamily 5M and related proteins, member of the class A family of ...
32-107 1.93e-20

olfactory receptor subfamily 5M and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5M and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320534  Cd Length: 279  Bit Score: 85.53  E-value: 1.93e-20
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15412     2 LLFVLFLVIYLITLLGNLGMILLIRLDSRLHTPMYFFLSHLSFVDLCYSSNVTPKMLVNFLSEKKTISFAGCFTQC 77
7tmA_OR12D-like cd15915
olfactory receptor subfamily 12D and related proteins, member of the class A family of ...
33-107 5.43e-20

olfactory receptor subfamily 12D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 12D and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320581 [Multi-domain]  Cd Length: 271  Bit Score: 84.28  E-value: 5.43e-20
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15915     3 LFVLFLLLYLASLLGNGAILAVVIAEPRLHSPMYFFLGNLSCLDIFYSSVTVPKMLAGLLSEHKTISFQGCISQL 77
7tmA_OR5H-like cd15409
olfactory receptor subfamily 5H and related proteins, member of the class A family of ...
32-107 7.60e-20

olfactory receptor subfamily 5H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5H, 5K, 5AC, 5T and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320531 [Multi-domain]  Cd Length: 279  Bit Score: 84.00  E-value: 7.60e-20
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15409     2 PLFLVFLAIYLITLVGNLGLIALIWKDSHLHTPMYFFLGNLAFADACTSSSVTPKMLVNFLSKNKMISFSGCAAQF 77
7tmA_OR2B-like cd15947
olfactory receptor subfamily 2B and related proteins, member of the class A family of ...
33-106 1.12e-19

olfactory receptor subfamily 2B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 2 (subfamilies 2B, 2C, 2G, 2H, 2I, 2J, 2W, 2Y) and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320613 [Multi-domain]  Cd Length: 270  Bit Score: 83.44  E-value: 1.12e-19
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQ 106
Cdd:cd15947     3 LFVVVLIFYLLTLLGNTAIILLSLLDPRLHTPMYFFLSNLSFLDLCFTTSIVPQMLVNLWGPDKTISYGGCVTQ 76
7tmA_OR5P-like cd15416
olfactory receptor subfamily 5P and related proteins, member of the class A family of ...
33-107 1.13e-19

olfactory receptor subfamily 5P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5P and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320538 [Multi-domain]  Cd Length: 279  Bit Score: 83.57  E-value: 1.13e-19
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15416     3 LFVLFLVIYSVTLLGNLSIILLIRISSQLHTPMYFFLSHLAFSDICYSSSVTPKMLVNFLVEKTTISYPGCAAQL 77
7tmA_OR4-like cd15226
olfactory receptor family 4 and related proteins, member of the class A family of ...
32-107 6.19e-19

olfactory receptor family 4 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 4 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320354 [Multi-domain]  Cd Length: 267  Bit Score: 81.10  E-value: 6.19e-19
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15226     2 FLFVFFSLFYVATVLGNLLIVVTVTSDPHLHSPMYFLLANLSFIDLCLSSFATPKMICDLLREHKTISFGGCMAQI 77
7tmA_OR10D-like cd15228
olfactory receptor subfamily 10D and related proteins, member of the class A family of ...
32-107 6.30e-19

olfactory receptor subfamily 10D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 10D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320356 [Multi-domain]  Cd Length: 275  Bit Score: 81.32  E-value: 6.30e-19
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15228     2 ILFVLFLAFYLCTLLGNLLILSAILSDPRLHTPMYFFLCNLSVFDIGFSSVSTPKMLAYLWGQSRVISLGGCMSQV 77
7tmA_OR11G-like cd15913
olfactory receptor OR11G and related proteins, member of the class A family of ...
31-106 7.98e-19

olfactory receptor OR11G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 11G, 11H, and related proteins in other mammals, and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320579  Cd Length: 270  Bit Score: 80.82  E-value: 7.98e-19
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQ 106
Cdd:cd15913     1 ILLFSFFSVIYILTLLGNGAIICAVWWDRRLHTPMYILLGNFSFLEICYVTSTVPNMLVNFLSETKTISFSGCFLQ 76
7tmA_OR1330-like cd15946
olfactory receptor 1330 and related proteins, member of the class A family of ...
32-107 1.45e-18

olfactory receptor 1330 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes olfactory receptors 1330 from mouse, Olr859 from rat, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320612  Cd Length: 270  Bit Score: 80.22  E-value: 1.45e-18
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15946     2 ILFAVFLLIYLSILLGNGLIITLICLDSRLHTPMYFFLSVLSLLDMSYVTTTVPQMLVHLLSHKKTISFTGCVAQM 77
7tmA_OR2W-like cd15434
olfactory receptor subfamily 2W and related proteins, member of the class A family of ...
32-107 1.86e-18

olfactory receptor subfamily 2W and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2W and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320551 [Multi-domain]  Cd Length: 277  Bit Score: 80.12  E-value: 1.86e-18
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15434     2 ILSVVVLIFYLLTLVGNTTIILVSCLDSRLHTPMYFFLANLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCAIQL 77
7tmA_OR8K-like cd15413
olfactory receptor subfamily 8K and related proteins, member of the class A family of ...
33-169 2.27e-18

olfactory receptor subfamily 8K and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8K, 8U, 8J, 5R, 5AL and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320535  Cd Length: 279  Bit Score: 80.06  E-value: 2.27e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQ------ 106
Cdd:cd15413     3 LFGLFLVIYLTTVMGNLGMIILTRLDSRLQTPMYFFLRHLAFVDLGYSTAVTPKMLVNFVVEQNTISFYACATQlafflt 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 107 ---------------------------------------------------MFFFIFFVTLFFGSGSIT----------- 124
Cdd:cd15413    83 fiiselfllsamaydryvaicnpllytvimsqrvcivlvaipylysffvalFHTIKTFRLSFCGSNVINhfycddlplla 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 125 ------------------------------------------------------------------------YLRPKSSH 132
Cdd:cd15413   163 lscsdthekeliilifagfnlissllivlvsylfilsailrirsaegrqkafstcgshltvvtifygtlifmYLQPKSSH 242
                         250       260       270
                  ....*....|....*....|....*....|....*..
gi 1720390524 133 LPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRK 169
Cdd:cd15413   243 SLDTDKMASVFYTLVIPMLNPLIYSLRNKEVKDALKK 279
7tmA_OR5C1-like cd15945
olfactory receptor subfamily 5C1 and related proteins, member of the class A family of ...
18-107 3.05e-18

olfactory receptor subfamily 5C1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5C1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320611  Cd Length: 292  Bit Score: 79.79  E-value: 3.05e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  18 FAFAKFSEVPEECFLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRG 97
Cdd:cd15945     1 FILLGFTDYLSLKVTLFLVFLLVYLLTLVGNVGMIILIRMDSQLHTPMYYFLSNLSFLDLCYSTAIGPKMLVDLLAKRKS 80
                          90
                  ....*....|
gi 1720390524  98 ISREGCATQM 107
Cdd:cd15945    81 IPFYGCALQM 90
7tmA_OR4D-like cd15936
olfactory receptor 4D and related proteins, member of the class A family of ...
31-107 3.93e-18

olfactory receptor 4D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320602 [Multi-domain]  Cd Length: 267  Bit Score: 78.92  E-value: 3.93e-18
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15936     1 FFLFLVFLLVYLTTWLGNLLIIITVISDPHLHTPMYFLLANLAFLDISFSSVTAPKMLSDLLSQTKTISFNGCMAQM 77
7tmA_OR8D-like cd15406
olfactory receptor subfamily 8D and related proteins, member of the class A family of ...
24-107 4.66e-18

olfactory receptor subfamily 8D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8D and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320528 [Multi-domain]  Cd Length: 290  Bit Score: 79.33  E-value: 4.66e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  24 SEVPEECFLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGC 103
Cdd:cd15406     3 TDQPELQLPLFLLFLGIYVVTVVGNLGMILLITLSSQLHTPMYYFLSNLSFIDLCYSSVITPKMLVNFVSEKNIISYPEC 82

                  ....
gi 1720390524 104 ATQM 107
Cdd:cd15406    83 MTQL 86
7tmA_OR2_unk cd15424
olfactory receptor family 2, unknown subfamily, member of the class A family of ...
32-107 7.26e-18

olfactory receptor family 2, unknown subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents an unknown subfamily, conserved in some mammalia and sauropsids, in family 2 of olfactory receptors. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320544 [Multi-domain]  Cd Length: 277  Bit Score: 78.62  E-value: 7.26e-18
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15424     2 LLFVVILIIYLLTILGNLVIIILVQTDSRLHTPMYFFLSHLAGLEICYVTSTLPQMLAHLLAGNGAISFARCTTQM 77
7tmA_OR4E-like cd15940
olfactory receptor 4E and related proteins, member of the class A family of ...
31-107 8.23e-18

olfactory receptor 4E and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4E and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320606 [Multi-domain]  Cd Length: 267  Bit Score: 78.25  E-value: 8.23e-18
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15940     1 LAFFMLFLVLYLLTLSGNILIMITIVMDPRLHTPMYFFLSNLSFIDICHSSVTVPKMLSDLLSEEKTISFNGCVTQL 77
7tmA_OR5G-like cd15414
olfactory receptor subfamily 5G and related proteins, member of the class A family of ...
32-175 1.56e-17

olfactory receptor subfamily 5G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5G and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320536 [Multi-domain]  Cd Length: 285  Bit Score: 77.85  E-value: 1.56e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM---- 107
Cdd:cd15414     2 PLFLLFLLVYLITLLGNLGMIILIQVDSRLHTPMYFFLSHLSFVDLCYSSVVTPKMLSDFFVEKKAISFLGCAAQMwffg 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 108 -----------------------------------------------------FFFIFFVTLFFGSGSI----------- 123
Cdd:cd15414    82 lfvaaecfllasmaydryvaicnpllytvimsqrvcvqlvvgpyvvgllntttHTTAAFFLPFCGPNVInhffcdippll 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 124 ------------------------------------------------------------------------TYLRPKSS 131
Cdd:cd15414   162 slscadtqinkwvlfimagalgvlsgliilvsyiyiliailrirsaegrrkafstcsshltavsilygtlffIYVRPSSS 241
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....
gi 1720390524 132 HLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRKTLSLKT 175
Cdd:cd15414   242 SSLDLDKVVSVFYTAVIPMLNPLIYSLRNKEVKDALRRTIRRKM 285
7tmA_OR9G-like cd15418
olfactory receptor subfamily 9G and related proteins, member of the class A family of ...
32-170 2.76e-17

olfactory receptor subfamily 9G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 9G and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320540 [Multi-domain]  Cd Length: 281  Bit Score: 77.13  E-value: 2.76e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM---- 107
Cdd:cd15418     3 ILFVVFLLSYILTLVGNLTLIALICLDSRLHTPMYFFVGNLSFLDLWYSSVYTPKILADCISKDKSISFAGCAAQFffsa 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524     --------------------------------------------------------------------------------
Cdd:cd15418    83 glaysecfllaamaydryvaicnpllyssamskklcmglvaasylggfanaiihtsntfrlhfcgdniidhffcdlpplv 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 108 --------------------------------------------------------FFFIFFVTLFFGSGSITYLRPKSS 131
Cdd:cd15418   163 klacddtrvyelilyfilgfnviaptalilasytfilaailrihsasgrhkafstcSAHLTSVTLYYGSILFIYSRPSSS 242
                         250       260       270
                  ....*....|....*....|....*....|....*....
gi 1720390524 132 HLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRKT 170
Cdd:cd15418   243 HTPDRDKVVALFYTVVNPLLNPLIYSLRNKDVKEALKKL 281
7tmA_OR2B2-like cd15432
olfactory receptor subfamily 2B2 and related proteins, member of the class A family of ...
32-107 2.82e-17

olfactory receptor subfamily 2B2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes transmembrane olfactory receptor subfamily 2B2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320549 [Multi-domain]  Cd Length: 277  Bit Score: 77.13  E-value: 2.82e-17
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15432     2 VLFVVFLIFYILTLLGNLAIILVSRLDPQLHTPMYFFLSNLSLLDLCYTTSTVPQMLVNLRSPQKTISYGGCVAQL 77
7tmA_OR5AR1-like cd15944
olfactory receptor subfamily 5AR1 and related proteins, member of the class A family of ...
18-106 1.23e-16

olfactory receptor subfamily 5AR1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AR1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320610 [Multi-domain]  Cd Length: 294  Bit Score: 75.59  E-value: 1.23e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  18 FAFAKFSEVPEECFLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRG 97
Cdd:cd15944     1 FILLGFTQDPQMQIILFVVFLIIYLVNVVGNLGMIILITTDSQLHTPMYFFLCNLSFCDLGYSSAIAPRMLADFLTKHKV 80

                  ....*....
gi 1720390524  98 ISREGCATQ 106
Cdd:cd15944    81 ISFSGCATQ 89
7tmA_OR2Y-like cd15433
olfactory receptor subfamily 2Y and related proteins, member of the class A family of ...
32-107 1.25e-16

olfactory receptor subfamily 2Y and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2Y, 2I, and related protein in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320550 [Multi-domain]  Cd Length: 277  Bit Score: 75.21  E-value: 1.25e-16
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15433     2 VLFVVVLIFYLLTLVGNTIIILLSVRDLRLHTPMYYFLCHLSFVDLCFTTSTVPQLLANLRGPALTITRGGCVAQL 77
7tmA_OR2D-like cd15428
olfactory receptor subfamily 2D and related proteins, member of the class A family of ...
32-167 2.63e-16

olfactory receptor subfamily 2D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320545 [Multi-domain]  Cd Length: 277  Bit Score: 74.44  E-value: 2.63e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQMFFFI 111
Cdd:cd15428     2 LLFILFLIIYLMTVLGNLLLVLLVIVDSHLHTPMYFFLSNLSVLELCYTTTVVPQMLVHLLSERKIISFIRCAAQLYFFL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 112 F------------------------------------------------------------------------------- 112
Cdd:cd15428    82 Sfgitecallsvmsydryvaiclplryslimtwkvcislatgswvggllvsavdtaftlnlsfgghnkinhflcempall 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524 113 -------------------------------------------------------------FVTLFFGSGSITYLRPKSS 131
Cdd:cd15428   162 klastdthqaemamfimcvftlvlpvllilasytriiytvfgmqsltgrlkafstcsshlmVVSLFYGSVLSTYMRPKSS 241
                         250       260       270
                  ....*....|....*....|....*....|....*.
gi 1720390524 132 HLPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAAL 167
Cdd:cd15428   242 TSKEYDKMISVFYIIVTPMLNPLIYSLRNKEVKHAL 277
7tmA_OR3A-like cd15233
olfactory receptor subfamily 3A3 and related proteins, member of the class A family of ...
31-107 3.74e-16

olfactory receptor subfamily 3A3 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 3A3 and 3A4, and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320361 [Multi-domain]  Cd Length: 277  Bit Score: 74.06  E-value: 3.74e-16
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15233     1 PVLFVTFLLAYIVTIGGNLSILAAILLEPKLHTPMYFFLGNLSLLDIGCISVTVPQMLVHLLSHKRTISYAACLSQL 77
7tmA_OR8B-like cd15405
olfactory receptor subfamily 8B and related proteins, member of the class A family of ...
31-107 6.07e-16

olfactory receptor subfamily 8B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8B and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320527 [Multi-domain]  Cd Length: 277  Bit Score: 73.22  E-value: 6.07e-16
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720390524  31 FLLFTLILLMFLVSLTGN-ALITLaICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15405     1 IPLFFLFLGIYVVTVVGNlGLITL-ICLNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLMNFVSEKNTISYAGCMTQL 77
7tmA_OR4N-like cd15937
olfactory receptor 4N, 4M, and related proteins, member of the class A family of ...
31-107 1.87e-15

olfactory receptor 4N, 4M, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4N, 4M, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320603  Cd Length: 267  Bit Score: 71.69  E-value: 1.87e-15
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15937     1 LLLFVLFLLFYLIILPGNILIILTIQGDPQLGSPMYFFLANLALLDICYSSITPPKMLADFFSERKTISYGGCMAQL 77
7tmA_OR5J-like cd15415
olfactory receptor subfamily 5J and related proteins, member of the class A family of ...
33-106 2.03e-15

olfactory receptor subfamily 5J and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5J and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320537 [Multi-domain]  Cd Length: 279  Bit Score: 72.06  E-value: 2.03e-15
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQ 106
Cdd:cd15415     3 LFMLFLLIYFITLLGNLGMIVLIRINPQLHTPMYFFLSNLSFVDLCYSSVFAPRLLVNFLVEKKTISYSACIAQ 76
7tmA_OR5B-like cd15407
olfactory receptor subfamily 5B and related proteins, member of the class A family of ...
31-107 2.05e-15

olfactory receptor subfamily 5B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5B and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320529  Cd Length: 279  Bit Score: 72.07  E-value: 2.05e-15
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLIllmFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15407     4 FIIFTLI---YLITLVGNLGMILLILLDSRLHTPMYFFLSNLSLVDIGYSSAVTPKVMAGLLTGDKVISYNACAAQM 77
7tmA_OR10G6-like cd15942
olfactory receptor subfamily 10G6 and related proteins, member of the class A family of ...
33-107 2.61e-15

olfactory receptor subfamily 10G6 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10G6 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320608  Cd Length: 275  Bit Score: 71.70  E-value: 2.61e-15
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15942     3 LFLFFLVVYLLTLSGNSLIILVVISDLQLHKPMYWFLCHLSILDMAVSTVVVPKVIAGFLSGGRIISFGGCVTQL 77
7tmA_OR1E-like cd15236
olfactory receptor subfamily 1E and related proteins, member of the class A family of ...
32-107 4.89e-15

olfactory receptor subfamily 1E and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 1E, 1J, and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320364 [Multi-domain]  Cd Length: 277  Bit Score: 70.95  E-value: 4.89e-15
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15236     2 VFFALFLAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDVSFSSVTVPKMLMNMQTQDQSIPYAGCISQM 77
7tmA_OR51-like cd15222
olfactory receptor family 51 and related proteins, member of the class A family of ...
31-107 4.92e-15

olfactory receptor family 51 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 51 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320350  Cd Length: 275  Bit Score: 70.61  E-value: 4.92e-15
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15222     1 HWISIPFCLLYLVALLGNSTILFVIKTEPSLHEPMYYFLSMLAVTDLGLSLSTLPTVLGIFWFNAREISFDACLAQM 77
7tmA_OR10G-like cd15916
olfactory receptor subfamily 10G and related proteins, member of the class A family of ...
32-107 2.60e-14

olfactory receptor subfamily 10G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 10G, 10S, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320582 [Multi-domain]  Cd Length: 276  Bit Score: 69.01  E-value: 2.60e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVS-EIRGISREGCATQM 107
Cdd:cd15916     2 LLFLIFLIIYLLTVLGNLLILLTVWVDSHLHRPMYIFLGHLSFLDMWLSTVTVPKMLAGFLEpGGKVISFGGCVAQL 78
7tmA_OR56-like cd15223
olfactory receptor family 56 and related proteins, member of the class A family of ...
32-107 3.88e-14

olfactory receptor family 56 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 56 and related proteins in other mammals, sauropsids, and fishes. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320351 [Multi-domain]  Cd Length: 279  Bit Score: 68.47  E-value: 3.88e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15223     2 WLSLPFLLLYLVALVANSLLLLIIKLERSLHQPMYILLGILAAVDIVLATTILPKMLAIFWFDANTISLPGCFAQM 77
7tmA_OR52E-like cd15952
olfactory receptor subfamily 52E and related proteins, member of the class A family of ...
39-107 5.70e-14

olfactory receptor subfamily 52E and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52E and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320618  Cd Length: 274  Bit Score: 67.79  E-value: 5.70e-14
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  39 LMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15952     9 AVYLIALLGNCTILFVIKTEQSLHQPMFYFLAMLSTIDLGLSTATIPKMLGIFWFNLREISFGGCLAQM 77
7tmA_OR51_52-like cd15917
olfactory receptor family 51, 52, 56 and related proteins, member of the class A family of ...
39-107 2.42e-13

olfactory receptor family 51, 52, 56 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 51, 52, 56, and related proteins in other mammals, sauropsids, amphibians, and fishes. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 341351  Cd Length: 275  Bit Score: 66.16  E-value: 2.42e-13
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  39 LMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15917     9 AMYLVALLGNITILFVIKIESSLHEPMYLFLAMLAATDLVLSTSTVPKMLGIFWFNAREISFDACLAQM 77
7tmA_OR4Q2-like cd15938
olfactory receptor 4Q2 and related proteins, member of the class A family of ...
32-107 4.41e-13

olfactory receptor 4Q2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 4Q2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320604 [Multi-domain]  Cd Length: 265  Bit Score: 65.28  E-value: 4.41e-13
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15938     2 LLFALFLLAYTMVLVGNLLIMVTVRSDPKLSSPMYFLLGNLSFLDLCYSTVTCPKMLVDFLSQRKAISYEACIAQL 77
7tmA_OR4Q3-like cd15935
olfactory receptor 4Q3 and related proteins, member of the class A family of ...
32-107 5.35e-13

olfactory receptor 4Q3 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 4Q3 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320601 [Multi-domain]  Cd Length: 268  Bit Score: 65.17  E-value: 5.35e-13
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPAL-HTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15935     2 LLFVLVLACYAAILLGNLLIVVTVHADPHLlQSPMYFFLANLSLIDMTLGSVAVPKVLADLLTCGRTISFGGCMAQL 78
7tmA_OR52P-like cd15953
olfactory receptor subfamily 52P and related proteins, member of the class A family of ...
39-107 1.39e-12

olfactory receptor subfamily 52P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52P and related proteins in other mammals, sauropsids and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 341354  Cd Length: 275  Bit Score: 64.21  E-value: 1.39e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  39 LMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15953     9 LMYIVTLLGNCTILFVVGKEQSLHKPMYLLLCMLALTDLVLSTSVVPKALCIFWFNLKEITFSGCLTQM 77
7tmA_OR10S1-like cd15941
olfactory receptor subfamily 10S1 and related proteins, member of the class A family of ...
31-107 2.24e-12

olfactory receptor subfamily 10S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10S1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320607 [Multi-domain]  Cd Length: 277  Bit Score: 63.33  E-value: 2.24e-12
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  31 FLLFTLILLMFLVSLTGNALITLAICTSPALHT-PMYFFLANLSLLEIGYTCSVIPKMLQNLVS-EIRGISREGCATQM 107
Cdd:cd15941     1 SLFFLLFLLIYLLTVLGNLLILLTIGSDPHLHGlPMYHFLGHLSFLDACLSSVTVPKVLAGLLTlSGRTISFEGCVVQL 79
7tmA_OR52B-like cd15221
olfactory receptor subfamily 52B and related proteins, member of the class A family of ...
39-107 3.61e-12

olfactory receptor subfamily 52B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor (OR) subfamilies 52B, 52D, 52H and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320349  Cd Length: 275  Bit Score: 62.69  E-value: 3.61e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  39 LMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15221     9 SMYIVALLGNSLLLFVIVTERSLHEPMYLFLSMLAVTDLLLSTTTVPKMLAIFWFGAGEISFDGCLTQM 77
7tmA_OR52I-like cd15950
olfactory receptor subfamily 52I and related proteins, member of the class A family of ...
40-107 7.93e-12

olfactory receptor subfamily 52I and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52I and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320616  Cd Length: 275  Bit Score: 62.05  E-value: 7.93e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720390524  40 MFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15950    10 MYVIALLGNGTILLVIKLDPSLHEPMYYFLCMLAVIDLVMSTSIVPKMLSIFWLGSAEISFEACFTQM 77
7tm_4 pfam13853
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
39-107 1.13e-10

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


Pssm-ID: 404695  Cd Length: 278  Bit Score: 58.67  E-value: 1.13e-10
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  39 LMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:pfam13853   3 LMYLIIFLGNGTILFVIKTESSLHQPMYLFLAMLALIDLGLSASTLPTVLGIFWFGLREISFEACLTQM 71
7tmA_OR52A-like cd15955
olfactory receptor subfamily 52A and related proteins, member of the class A family of ...
40-107 5.58e-10

olfactory receptor subfamily 52A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52A and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320621 [Multi-domain]  Cd Length: 276  Bit Score: 56.70  E-value: 5.58e-10
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720390524  40 MFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15955    10 MFLLAVLGNCTLLIVIKRERSLHQPMYIFLAMLAATDLGLCPCILPKMLAIFWFQLREISFNACLAQM 77
7tmA_OR52R_52L-like cd15951
olfactory receptor subfamily 52R, 52L, and related proteins, member of the class A family of ...
39-107 7.82e-10

olfactory receptor subfamily 52R, 52L, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamilies 52R, 52L and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320617  Cd Length: 275  Bit Score: 56.20  E-value: 7.82e-10
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  39 LMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15951     9 IMYAVALLGNFTILFIVKTEPSLHEPMYLFLCMLAITDLVLSTSTLPKMLSIFWFNSREIDFSACLTQM 77
7tmA_OR10S1-like cd15941
olfactory receptor subfamily 10S1 and related proteins, member of the class A family of ...
119-167 1.23e-08

olfactory receptor subfamily 10S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10S1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320607 [Multi-domain]  Cd Length: 277  Bit Score: 52.93  E-value: 1.23e-08
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 1720390524 119 GSGSITYLRPKSSHlpGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAAL 167
Cdd:cd15941   231 VPSVFIYLQPSSSQ--AGAGAPAVFYTIVTPMLNPFIYTLRNKEVKRAL 277
7tmA_OR52W-like cd15956
olfactory receptor subfamily 52W and related proteins, member of the class A family of ...
40-107 1.36e-08

olfactory receptor subfamily 52W and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52W and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320622 [Multi-domain]  Cd Length: 275  Bit Score: 52.94  E-value: 1.36e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720390524  40 MFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15956    10 IYVLSLLGNGVLLSVVWKEHRLHQPMFLFLAMLAATDLVLALSTAPKLLAILWFGATAISSYVCLSQM 77
7tmA_OR52K-like cd15948
olfactory receptor subfamily 52K and related proteins, member of the class A family of ...
40-107 1.39e-08

olfactory receptor subfamily 52K and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52K and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320614 [Multi-domain]  Cd Length: 277  Bit Score: 52.98  E-value: 1.39e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720390524  40 MFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15948    11 AFTVALLGNCTLLYVIKTEPSLHEPMFYFLAMLAVIDLVLSTTTVPKILSIFWFNSREINFNACLVQM 78
7tmA_OR52M-like cd15949
olfactory receptor subfamily 52M and related proteins, member of the class A family of ...
40-107 2.38e-08

olfactory receptor subfamily 52M and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52M and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320615  Cd Length: 292  Bit Score: 52.09  E-value: 2.38e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720390524  40 MFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15949    26 MYLIAVLGNCTILFIIKSEPSLHQPMYFFLSMLAIIDLVLSTSTMPKLLAIFWFSSNEIPLHACLLQM 93
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
33-103 8.19e-08

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 50.36  E-value: 8.19e-08
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGC 103
Cdd:cd00637     1 LAVLYILIFVVGLVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGLLVIPFSLVSLLLGRWWFGDALC 71
7tmA_OR52N-like cd15954
olfactory receptor subfamily 52N and related proteins, member of the class A family of ...
40-107 2.10e-07

olfactory receptor subfamily 52N and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52N and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320620  Cd Length: 276  Bit Score: 49.44  E-value: 2.10e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1720390524  40 MFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGCATQM 107
Cdd:cd15954    10 MYIIAMVGNCGLLYLIWIEEALHRPMYYFLSMLSFTDITLCTTMVPKAMCIFWFNLKEISFNACLVQM 77
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
47-107 6.41e-05

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 41.90  E-value: 6.41e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1720390524  47 GNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRG-ISREGCATQM 107
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFSLLTLPFWLVYYLNHGDWpFGSALCKIVG 62
7tmA_Melanopsin-like cd15083
vertebrate melanopsins and related opsins, member of the class A family of seven-transmembrane ...
35-103 3.86e-04

vertebrate melanopsins and related opsins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represent the Gq-coupled rhodopsin subfamily consists of melanopsins, insect photoreceptors R1-R6, invertebrate Gq opsins as well as their closely related opsins. Melanopsins (also called Opsin-4) are the primary photoreceptor molecules for non-visual functions such as the photo-entrainment of the circadian rhythm and pupillary constriction in mammals. Mammalian melanopsins are expressed only in the inner retina, whereas non-mammalian vertebrate melanopsins are localized in various extra-retinal tissues such as iris, brain, pineal gland, and skin. The outer photoreceptors (R1-R6) are the insect Drosophila equivalent to the vertebrate rods and are responsible for image formation and motion detection. The invertebrate G(q) opsins includes the arthropod and mollusk visual opsins as well as invertebrate melanopsins, which are also found in vertebrates. Arthropods possess color vision by the use of multiple opsins sensitive to different light wavelengths. Members of this subfamily belong to the class A of the G protein-coupled receptors and have seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops.


Pssm-ID: 320211 [Multi-domain]  Cd Length: 291  Bit Score: 40.01  E-value: 3.86e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1720390524  35 TLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLVSEIRGISREGC 103
Cdd:cd15083     5 IFILIIGLIGVVGNGLVIYAFCRFKSLRTPANYLIINLAISDFLMCILNCPLMVISSFSGRWIFGKTGC 73
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
32-74 4.13e-04

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098 [Multi-domain]  Cd Length: 259  Bit Score: 39.47  E-value: 4.13e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|...
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSL 74
Cdd:cd14967     1 LLAVFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAV 43
7tmA_SREB-like cd15005
super conserved receptor expressed in brain and related proteins, member of the class A family ...
31-77 9.09e-04

super conserved receptor expressed in brain and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The SREB (super conserved receptor expressed in brain) subfamily consists of at least three members, named SREB1 (GPR27), SREB2 (GPR85), and SREB3 (GPR173). They are very highly conserved G protein-coupled receptors throughout vertebrate evolution, however no endogenous ligands have yet been identified. SREB2 is greatly expressed in brain regions involved in psychiatric disorders and cognition, such as the hippocampal dentate gyrus. Genetic studies in both humans and mice have shown that SREB2 influences brain size and negatively regulates hippocampal adult neurogenesis and neurogenesis-dependent cognitive function, all of which are suggesting a potential link between SREB2 and schizophrenia. All three SREB genes are highly expressed in differentiated hippocampal neural stem cells. Furthermore, all GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320134 [Multi-domain]  Cd Length: 329  Bit Score: 38.98  E-value: 9.09e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 1720390524  31 FLLFTLILLMfLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEI 77
Cdd:cd15005     2 LKLTTLGLIL-CVSLAGNLLFSVLIVRDRSLHRAPYYFLLDLCLADG 47
7tmA_alpha2B_AR cd15321
alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G ...
35-90 1.49e-03

alpha-2 adrenergic receptors subtype B, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320444 [Multi-domain]  Cd Length: 268  Bit Score: 37.98  E-value: 1.49e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1720390524  35 TLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQN 90
Cdd:cd15321    11 AAITFLILFTIFGNVLVIIAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLAN 66
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
38-91 1.51e-03

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 37.96  E-value: 1.51e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 1720390524  38 LLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIP-KMLQNL 91
Cdd:cd14993     8 VVVFLLALVGNSLVIAVVLRNKHMRTVTNYFLVNLAVADLLVSLFCMPlTLLENV 62
7tmA_EDG-like cd14972
endothelial differentiation gene family, member of the class A family of seven-transmembrane G ...
42-72 2.09e-03

endothelial differentiation gene family, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents the endothelial differentiation gene (Edg) family of G-protein coupled receptors, melanocortin/ACTH receptors, and cannabinoid receptors as well as their closely related receptors. The Edg GPCRs bind blood borne lysophospholipids including sphingosine-1-phosphate (S1P) and lysophosphatidic acid (LPA), which are involved in the regulation of cell proliferation, survival, migration, invasion, endothelial cell shape change and cytoskeletal remodeling. The Edg receptors are classified into two subfamilies: the lysophosphatidic acid subfamily that includes LPA1 (Edg2), LPA2 (Edg4), and LPA3 (Edg7); and the S1P subfamily that includes S1P1 (Edg1), S1P2 (Edg5), S1P3 (Edg3), S1P4 (Edg6), and S1P5 (Edg8). Melanocortin receptors bind a group of pituitary peptide hormones known as melanocortins, which include adrenocorticotropic hormone (ACTH) and the different isoforms of melanocyte-stimulating hormones. Two types of cannabinoid receptors, CB1 and CB2, are activated by naturally occurring endocannabinoids, cannabis plant-derived cannabinoids such as tetrahydrocannabinol, or synthetic cannabinoids. The CB receptors are involved in the various physiological processes such as appetite, mood, memory, and pain sensation. CB1 receptor is expressed predominantly in central and peripheral neurons, while CB2 receptor is found mainly in the immune system.


Pssm-ID: 341317 [Multi-domain]  Cd Length: 275  Bit Score: 37.66  E-value: 2.09e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 1720390524  42 LVSLTGNALITLAICTSPALHTPMYFFLANL 72
Cdd:cd14972    10 VFIVVENSLVLAAIIKNRRLHKPMYILIANL 40
7tmA_alpha2A_AR cd15322
alpha-2 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G ...
33-92 3.19e-03

alpha-2 adrenergic receptors subtype A, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320445 [Multi-domain]  Cd Length: 259  Bit Score: 37.23  E-value: 3.19e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 1720390524  33 LFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLV 92
Cdd:cd15322     3 LIILVGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEV 62
7tmA_alpha-2D_AR cd15324
alpha-2 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G ...
32-92 6.11e-03

alpha-2 adrenergic receptors subtype D, member of the class A family of seven-transmembrane G protein-coupled receptors; The alpha-2 adrenergic receptors (or adrenoceptors) are a subfamily of the class A rhodopsin-like GPCRs that share a common architecture of seven transmembrane helices. This subfamily consists of three highly homologous receptor subtypes that have a key role in neurotransmitter release: alpha-2A, alpha-2B, and alpha-2C. In addition, a fourth subtype, alpha-2D is present in ray-finned fishes and amphibians, but is not found in humans. The alpha-2 receptors are found in both central and peripheral nervous system and serve to produce inhibitory functions through the G(i) proteins. Thus, the alpha-2 receptors inhibit adenylate cyclase, which decreases cAMP production and thereby decreases calcium influx during the action potential. Consequently, lowered levels of calcium will lead to a decrease in neurotransmitter release by negative feedback.


Pssm-ID: 320447 [Multi-domain]  Cd Length: 256  Bit Score: 36.39  E-value: 6.11e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1720390524  32 LLFTLILLMFLVSLTGNALITLAICTSPALHTPMYFFLANLSLLEIGYTCSVIPKMLQNLV 92
Cdd:cd15324     2 LIVLVVVVIILVTIVGNVLVVVAVFTSRALRAPQNLFLVSLASADILVATLVIPFSLANEV 62
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH