NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|578801279|ref|XP_006711516|]
View 

sugar transporter SWEET1 isoform X3 [Homo sapiens]

Protein Classification

SWEET family sugar transporter( domain architecture ID 10503726)

SWEET family sugar transporter similar to plant SWEET bidirectional sugar transporters that mediate both low-affinity uptake and efflux of sugar across the plasma membrane

CATH:  1.20.1280.290
Gene Ontology:  GO:0051119
PubMed:  25988582
SCOP:  3002472

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
MtN3_slv pfam03083
Sugar efflux transporter for intercellular exchange; This family includes proteins such as ...
 9-95 2.55e-29

Sugar efflux transporter for intercellular exchange; This family includes proteins such as drosophila saliva, MtN3 involved in root nodule development and a protein involved in activation and expression of recombination activation genes (RAGs). Although the molecular function of these proteins is unknown, they are almost certainly transmembrane proteins. This family contains a region of two transmembrane helices that is found in two copies in most members of the family. This family also contains specific sugar efflux transporters that are essential for the maintenance of animal blood glucose levels, plant nectar production, and plant seed and pollen development. In many organizims it meditaes gluose transport; in Arabidopsis it is necessary for pollen viability; and two of the rice homologs are specifically exploited by bacterial pathogens for virulence by means of direct binding of a bacterial effector to the SWEET promoter.


:

Pssm-ID: 397278  Cd Length: 87  Bit Score: 103.81  E-value: 2.55e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 578801279    9 SLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYL 88
Cdd:pfam03083   1 FLLGILCVVFTVAMFLSPLSILRKIIKTKSTEGMPFLPFLAGLLSASLWLLYGLLKKDGYIIIPNGIGCFLGTIYLILFI 80


                  ....*..
gi 578801279   89 HYCPRKR 95
Cdd:pfam03083  81 VYPPKKA 87
MtN3_slv pfam03083
Sugar efflux transporter for intercellular exchange; This family includes proteins such as ...
 127-188 1.61e-20

Sugar efflux transporter for intercellular exchange; This family includes proteins such as drosophila saliva, MtN3 involved in root nodule development and a protein involved in activation and expression of recombination activation genes (RAGs). Although the molecular function of these proteins is unknown, they are almost certainly transmembrane proteins. This family contains a region of two transmembrane helices that is found in two copies in most members of the family. This family also contains specific sugar efflux transporters that are essential for the maintenance of animal blood glucose levels, plant nectar production, and plant seed and pollen development. In many organizims it meditaes gluose transport; in Arabidopsis it is necessary for pollen viability; and two of the rice homologs are specifically exploited by bacterial pathogens for virulence by means of direct binding of a bacterial effector to the SWEET promoter.


:

Pssm-ID: 397278  Cd Length: 87  Bit Score: 81.09  E-value: 1.61e-20
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 578801279  127 QQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIM 188
Cdd:pfam03083   1 FLLGILCVVFTVAMFLSPLSILRKIIKTKSTEGMPFLPFLAGLLSASLWLLYGLLKKDGYII 62
 
Name Accession Description Interval E-value
MtN3_slv pfam03083
Sugar efflux transporter for intercellular exchange; This family includes proteins such as ...
 9-95 2.55e-29

Sugar efflux transporter for intercellular exchange; This family includes proteins such as drosophila saliva, MtN3 involved in root nodule development and a protein involved in activation and expression of recombination activation genes (RAGs). Although the molecular function of these proteins is unknown, they are almost certainly transmembrane proteins. This family contains a region of two transmembrane helices that is found in two copies in most members of the family. This family also contains specific sugar efflux transporters that are essential for the maintenance of animal blood glucose levels, plant nectar production, and plant seed and pollen development. In many organizims it meditaes gluose transport; in Arabidopsis it is necessary for pollen viability; and two of the rice homologs are specifically exploited by bacterial pathogens for virulence by means of direct binding of a bacterial effector to the SWEET promoter.


Pssm-ID: 397278  Cd Length: 87  Bit Score: 103.81  E-value: 2.55e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 578801279    9 SLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYL 88
Cdd:pfam03083   1 FLLGILCVVFTVAMFLSPLSILRKIIKTKSTEGMPFLPFLAGLLSASLWLLYGLLKKDGYIIIPNGIGCFLGTIYLILFI 80


                  ....*..
gi 578801279   89 HYCPRKR 95
Cdd:pfam03083  81 VYPPKKA 87
MtN3_slv pfam03083
Sugar efflux transporter for intercellular exchange; This family includes proteins such as ...
 127-188 1.61e-20

Sugar efflux transporter for intercellular exchange; This family includes proteins such as drosophila saliva, MtN3 involved in root nodule development and a protein involved in activation and expression of recombination activation genes (RAGs). Although the molecular function of these proteins is unknown, they are almost certainly transmembrane proteins. This family contains a region of two transmembrane helices that is found in two copies in most members of the family. This family also contains specific sugar efflux transporters that are essential for the maintenance of animal blood glucose levels, plant nectar production, and plant seed and pollen development. In many organizims it meditaes gluose transport; in Arabidopsis it is necessary for pollen viability; and two of the rice homologs are specifically exploited by bacterial pathogens for virulence by means of direct binding of a bacterial effector to the SWEET promoter.


Pssm-ID: 397278  Cd Length: 87  Bit Score: 81.09  E-value: 1.61e-20
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 578801279  127 QQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIM 188
Cdd:pfam03083   1 FLLGILCVVFTVAMFLSPLSILRKIIKTKSTEGMPFLPFLAGLLSASLWLLYGLLKKDGYII 62
 
Name Accession Description Interval E-value
MtN3_slv pfam03083
Sugar efflux transporter for intercellular exchange; This family includes proteins such as ...
 9-95 2.55e-29

Sugar efflux transporter for intercellular exchange; This family includes proteins such as drosophila saliva, MtN3 involved in root nodule development and a protein involved in activation and expression of recombination activation genes (RAGs). Although the molecular function of these proteins is unknown, they are almost certainly transmembrane proteins. This family contains a region of two transmembrane helices that is found in two copies in most members of the family. This family also contains specific sugar efflux transporters that are essential for the maintenance of animal blood glucose levels, plant nectar production, and plant seed and pollen development. In many organizims it meditaes gluose transport; in Arabidopsis it is necessary for pollen viability; and two of the rice homologs are specifically exploited by bacterial pathogens for virulence by means of direct binding of a bacterial effector to the SWEET promoter.


Pssm-ID: 397278  Cd Length: 87  Bit Score: 103.81  E-value: 2.55e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 578801279    9 SLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYL 88
Cdd:pfam03083   1 FLLGILCVVFTVAMFLSPLSILRKIIKTKSTEGMPFLPFLAGLLSASLWLLYGLLKKDGYIIIPNGIGCFLGTIYLILFI 80


                  ....*..
gi 578801279   89 HYCPRKR 95
Cdd:pfam03083  81 VYPPKKA 87
MtN3_slv pfam03083
Sugar efflux transporter for intercellular exchange; This family includes proteins such as ...
 127-188 1.61e-20

Sugar efflux transporter for intercellular exchange; This family includes proteins such as drosophila saliva, MtN3 involved in root nodule development and a protein involved in activation and expression of recombination activation genes (RAGs). Although the molecular function of these proteins is unknown, they are almost certainly transmembrane proteins. This family contains a region of two transmembrane helices that is found in two copies in most members of the family. This family also contains specific sugar efflux transporters that are essential for the maintenance of animal blood glucose levels, plant nectar production, and plant seed and pollen development. In many organizims it meditaes gluose transport; in Arabidopsis it is necessary for pollen viability; and two of the rice homologs are specifically exploited by bacterial pathogens for virulence by means of direct binding of a bacterial effector to the SWEET promoter.


Pssm-ID: 397278  Cd Length: 87  Bit Score: 81.09  E-value: 1.61e-20
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 578801279  127 QQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIM 188
Cdd:pfam03083   1 FLLGILCVVFTVAMFLSPLSILRKIIKTKSTEGMPFLPFLAGLLSASLWLLYGLLKKDGYII 62
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH