NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568971899|ref|XP_006532406|]
View 

conserved oligomeric Golgi complex subunit 1 isoform X1 [Mus musculus]

Protein Classification

COG1/VPS51 family protein( domain architecture ID 10554766)

COG1/VPS51 family protein similar to Homo sapiens conserved oligomeric Golgi complex subunit 1 (COG1) and Schizosaccharomyces pombe vacuolar protein sorting-associated protein 51 (VPS51)

Gene Ontology:  GO:0015031
PubMed:  11980916

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Vps51 pfam08700
Vps51/Vps67; This family includes a presumed domain found in a number of components of ...
 39-114 3.15e-12

Vps51/Vps67; This family includes a presumed domain found in a number of components of vesicular transport. The VFT tethering complex (also known as GARP complex, Golgi associated retrograde protein complex, Vps53 tethering complex) is a conserved eukaryotic docking complex which is involved recycling of proteins from endosomes to the late Golgi. Vps51 (also known as Vps67) is a subunit of VFT and interacts with the SNARE Tlg1. Cog1_N is the N-terminus of the Cog1 subunit of the eight-unit Conserved Oligomeric Golgi (COG) complex that participates in retrograde vesicular transport and is required to maintain normal Golgi structure and function. The subunits are located in two lobes and Cog1 serves to bind the two lobes together probably via the highly conserved N-terminal domain of approximately 85 residues.


:

Pssm-ID: 462568  Cd Length: 86  Bit Score: 63.07  E-value: 3.15e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568971899   39 DPNALFE----THGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGLVDAVQATDQYCARLRQ 114
Cdd:pfam08700   7 DADRYVSellsKATLEELLQFESSLRSEIERLDSELKQLVYDNYRDLIKAADTISKMKSEMEQLSQKLSELKQALSKIAS 86
 
Name Accession Description Interval E-value
Vps51 pfam08700
Vps51/Vps67; This family includes a presumed domain found in a number of components of ...
 39-114 3.15e-12

Vps51/Vps67; This family includes a presumed domain found in a number of components of vesicular transport. The VFT tethering complex (also known as GARP complex, Golgi associated retrograde protein complex, Vps53 tethering complex) is a conserved eukaryotic docking complex which is involved recycling of proteins from endosomes to the late Golgi. Vps51 (also known as Vps67) is a subunit of VFT and interacts with the SNARE Tlg1. Cog1_N is the N-terminus of the Cog1 subunit of the eight-unit Conserved Oligomeric Golgi (COG) complex that participates in retrograde vesicular transport and is required to maintain normal Golgi structure and function. The subunits are located in two lobes and Cog1 serves to bind the two lobes together probably via the highly conserved N-terminal domain of approximately 85 residues.


Pssm-ID: 462568  Cd Length: 86  Bit Score: 63.07  E-value: 3.15e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568971899   39 DPNALFE----THGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGLVDAVQATDQYCARLRQ 114
Cdd:pfam08700   7 DADRYVSellsKATLEELLQFESSLRSEIERLDSELKQLVYDNYRDLIKAADTISKMKSEMEQLSQKLSELKQALSKIAS 86
 
Name Accession Description Interval E-value
Vps51 pfam08700
Vps51/Vps67; This family includes a presumed domain found in a number of components of ...
 39-114 3.15e-12

Vps51/Vps67; This family includes a presumed domain found in a number of components of vesicular transport. The VFT tethering complex (also known as GARP complex, Golgi associated retrograde protein complex, Vps53 tethering complex) is a conserved eukaryotic docking complex which is involved recycling of proteins from endosomes to the late Golgi. Vps51 (also known as Vps67) is a subunit of VFT and interacts with the SNARE Tlg1. Cog1_N is the N-terminus of the Cog1 subunit of the eight-unit Conserved Oligomeric Golgi (COG) complex that participates in retrograde vesicular transport and is required to maintain normal Golgi structure and function. The subunits are located in two lobes and Cog1 serves to bind the two lobes together probably via the highly conserved N-terminal domain of approximately 85 residues.


Pssm-ID: 462568  Cd Length: 86  Bit Score: 63.07  E-value: 3.15e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 568971899   39 DPNALFE----THGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGLVDAVQATDQYCARLRQ 114
Cdd:pfam08700   7 DADRYVSellsKATLEELLQFESSLRSEIERLDSELKQLVYDNYRDLIKAADTISKMKSEMEQLSQKLSELKQALSKIAS 86
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH