Elongin BC and Polycomb repressive complex 2-associated protein; This family of proteins is found in eukaryotes. Family members are approximately 835 amino acids in length and include the polycomb repressive complex 2-associated factor EPOP (Elongin BC and Polycomb Repressive Complex 2 (PRC2) Associated Protein, also termed C17orf96, esPRC2p48, E130012A19Rik), a scaffold protein expressed in the inner cell mass of the mouse blastocyst serving as a bridging partner between the PRC2/EED-EZH2 complex and the elongin BC complex, and fine-tuning the transcriptional status of Polycomb group (PcG) target genes in embryonic stem cells. Both EPOP and Elongin BC are required to maintain low levels of expression at PRC2 genomic targets. EPOP interacts with the H2B deubiquitinase USP7 to modulate transcriptional processes in mESCs similar to MYC. Functional studies found that the C-terminal region of EPOP directly interacts with PRC2 and that this region associates with the VEFS-box of the PRC2 core member SUZ12. Thus, suggesting that EPOP may directly affect PRC2 chromatin binding by altering the functionality of Suz12. This region is proposed to have evolved in early vertebrates and is also present in the paralog SKIDA1 (C10orf140) another novel PRC2-interacting protein, supporting the idea that proteins possessing this sequence are PRC2 regulators in the entire vertebrate branch. The family is found in association with pfam02437.

                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 111185892  295 PTLPTSSTFSLLDCFPCPPALVVEENGDLGPASSLRLQGDAKPP-PAHPLWKWQMGGPAVPEPPGLK 360
Cdd:pfam15223 356 VASPVKKPFNFMANFPSPPSLIIGNDGDLAPAYSLNSEKDPQPPhKSHPVWKWQLGGSAIPLPPSHK 422

Elongin BC and Polycomb repressive complex 2-associated protein; This family of proteins is found in eukaryotes. Family members are approximately 835 amino acids in length and include the polycomb repressive complex 2-associated factor EPOP (Elongin BC and Polycomb Repressive Complex 2 (PRC2) Associated Protein, also termed C17orf96, esPRC2p48, E130012A19Rik), a scaffold protein expressed in the inner cell mass of the mouse blastocyst serving as a bridging partner between the PRC2/EED-EZH2 complex and the elongin BC complex, and fine-tuning the transcriptional status of Polycomb group (PcG) target genes in embryonic stem cells. Both EPOP and Elongin BC are required to maintain low levels of expression at PRC2 genomic targets. EPOP interacts with the H2B deubiquitinase USP7 to modulate transcriptional processes in mESCs similar to MYC. Functional studies found that the C-terminal region of EPOP directly interacts with PRC2 and that this region associates with the VEFS-box of the PRC2 core member SUZ12. Thus, suggesting that EPOP may directly affect PRC2 chromatin binding by altering the functionality of Suz12. This region is proposed to have evolved in early vertebrates and is also present in the paralog SKIDA1 (C10orf140) another novel PRC2-interacting protein, supporting the idea that proteins possessing this sequence are PRC2 regulators in the entire vertebrate branch. The family is found in association with pfam02437.

                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 111185892  295 PTLPTSSTFSLLDCFPCPPALVVEENGDLGPASSLRLQGDAKPP-PAHPLWKWQMGGPAVPEPPGLK 360
Cdd:pfam15223 356 VASPVKKPFNFMANFPSPPSLIIGNDGDLAPAYSLNSEKDPQPPhKSHPVWKWQLGGSAIPLPPSHK 422

Elongin BC and Polycomb repressive complex 2-associated protein; This family of proteins is found in eukaryotes. Family members are approximately 835 amino acids in length and include the polycomb repressive complex 2-associated factor EPOP (Elongin BC and Polycomb Repressive Complex 2 (PRC2) Associated Protein, also termed C17orf96, esPRC2p48, E130012A19Rik), a scaffold protein expressed in the inner cell mass of the mouse blastocyst serving as a bridging partner between the PRC2/EED-EZH2 complex and the elongin BC complex, and fine-tuning the transcriptional status of Polycomb group (PcG) target genes in embryonic stem cells. Both EPOP and Elongin BC are required to maintain low levels of expression at PRC2 genomic targets. EPOP interacts with the H2B deubiquitinase USP7 to modulate transcriptional processes in mESCs similar to MYC. Functional studies found that the C-terminal region of EPOP directly interacts with PRC2 and that this region associates with the VEFS-box of the PRC2 core member SUZ12. Thus, suggesting that EPOP may directly affect PRC2 chromatin binding by altering the functionality of Suz12. This region is proposed to have evolved in early vertebrates and is also present in the paralog SKIDA1 (C10orf140) another novel PRC2-interacting protein, supporting the idea that proteins possessing this sequence are PRC2 regulators in the entire vertebrate branch. The family is found in association with pfam02437.

                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 111185892  295 PTLPTSSTFSLLDCFPCPPALVVEENGDLGPASSLRLQGDAKPP-PAHPLWKWQMGGPAVPEPPGLK 360
Cdd:pfam15223 356 VASPVKKPFNFMANFPSPPSLIIGNDGDLAPAYSLNSEKDPQPPhKSHPVWKWQLGGSAIPLPPSHK 422