NLS-binding and DNA-binding and dimerization domains of Nrf1; In Drosophila, the erect wing (ewg) protein is required for proper development of the central nervous system and the indirect flight muscles. The fly ewg gene encodes a novel DNA-binding domain that is also found in four genes previously identified in sea urchin, chicken, zebrafish, and human. Nuclear respiratory factor-1 is a transcriptional activator that has been implicated in the nuclear control of respiratory chain expression in vertebrates. The first 26 amino acids of nuclear respiratory factor-1 are required for the binding of dynein light chain. The interaction with dynein light chain is observed for both ewg and Nrf-1, transcription factors that are structurally and functionally similar between humans and Drosophila. The highest level of expression of both ewg and Nrf-1 was found in the central nervous system, somites, first branchial arch, optic vesicle, and otic vesicle. In the mouse Nrf-1 protein, Swiss-Prot:Q8C4C0, there is also an NLS domain at 88-116, and a DNA binding and dimerization domain at 127-282. Ewg is a site-specific transcriptional activator, and evolutionarily conserved regions of ewg contribute both positively and negatively to transcriptional activity.

                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24583270    15 LPLLFANGYPTSLEKITESQLENFIPFMVQCSLGHINLPKKIDCSEPEWWPESAPFEIPLKKPKAFVGN----WMEKMKE 90
Cdd:pfam10491 115 LPPLVIDGIPTPVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCRPVWWPKDVPWANVRSDVRTEEQKqrvsWTQALRT 194

                          90
                  ....*....|....*
gi 24583270    91 IVVICYQFHKSLFLL 105
Cdd:pfam10491 195 IVKNCYKHHGREDLL 209

NLS-binding and DNA-binding and dimerization domains of Nrf1; In Drosophila, the erect wing (ewg) protein is required for proper development of the central nervous system and the indirect flight muscles. The fly ewg gene encodes a novel DNA-binding domain that is also found in four genes previously identified in sea urchin, chicken, zebrafish, and human. Nuclear respiratory factor-1 is a transcriptional activator that has been implicated in the nuclear control of respiratory chain expression in vertebrates. The first 26 amino acids of nuclear respiratory factor-1 are required for the binding of dynein light chain. The interaction with dynein light chain is observed for both ewg and Nrf-1, transcription factors that are structurally and functionally similar between humans and Drosophila. The highest level of expression of both ewg and Nrf-1 was found in the central nervous system, somites, first branchial arch, optic vesicle, and otic vesicle. In the mouse Nrf-1 protein, Swiss-Prot:Q8C4C0, there is also an NLS domain at 88-116, and a DNA binding and dimerization domain at 127-282. Ewg is a site-specific transcriptional activator, and evolutionarily conserved regions of ewg contribute both positively and negatively to transcriptional activity.

                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24583270    15 LPLLFANGYPTSLEKITESQLENFIPFMVQCSLGHINLPKKIDCSEPEWWPESAPFEIPLKKPKAFVGN----WMEKMKE 90
Cdd:pfam10491 115 LPPLVIDGIPTPVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCRPVWWPKDVPWANVRSDVRTEEQKqrvsWTQALRT 194

                          90
                  ....*....|....*
gi 24583270    91 IVVICYQFHKSLFLL 105
Cdd:pfam10491 195 IVKNCYKHHGREDLL 209

NLS-binding and DNA-binding and dimerization domains of Nrf1; In Drosophila, the erect wing (ewg) protein is required for proper development of the central nervous system and the indirect flight muscles. The fly ewg gene encodes a novel DNA-binding domain that is also found in four genes previously identified in sea urchin, chicken, zebrafish, and human. Nuclear respiratory factor-1 is a transcriptional activator that has been implicated in the nuclear control of respiratory chain expression in vertebrates. The first 26 amino acids of nuclear respiratory factor-1 are required for the binding of dynein light chain. The interaction with dynein light chain is observed for both ewg and Nrf-1, transcription factors that are structurally and functionally similar between humans and Drosophila. The highest level of expression of both ewg and Nrf-1 was found in the central nervous system, somites, first branchial arch, optic vesicle, and otic vesicle. In the mouse Nrf-1 protein, Swiss-Prot:Q8C4C0, there is also an NLS domain at 88-116, and a DNA binding and dimerization domain at 127-282. Ewg is a site-specific transcriptional activator, and evolutionarily conserved regions of ewg contribute both positively and negatively to transcriptional activity.

                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24583270    15 LPLLFANGYPTSLEKITESQLENFIPFMVQCSLGHINLPKKIDCSEPEWWPESAPFEIPLKKPKAFVGN----WMEKMKE 90
Cdd:pfam10491 115 LPPLVIDGIPTPVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCRPVWWPKDVPWANVRSDVRTEEQKqrvsWTQALRT 194

                          90
                  ....*....|....*
gi 24583270    91 IVVICYQFHKSLFLL 105
Cdd:pfam10491 195 IVKNCYKHHGREDLL 209