NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|22328898|ref|NP_194151|]
View 

Transcription elongation factor (TFIIS) family protein [Arabidopsis thaliana]

Protein Classification

transcription factor IIS helical bundle-like domain-containing protein( domain architecture ID 10555158)

transcription factor IIS (TFIIS) helical bundle-like domain-containing protein similar to mediator of RNA polymerase II transcription subunit 26 (Med26), a component of the Mediator complex, which is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Med26 pfam08711
TFIIS helical bundle-like domain; Mediator is a large complex of up to 33 proteins that is ...
100-148 7.11e-04

TFIIS helical bundle-like domain; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species {1-2]. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. Notably, the 'small' and 'large' Mediator complexes differ in their subunit composition: the Med26 subunit preferentially associates with the small, active complex, whereas cdk8, cyclin C, Med12 and Med13 associate with the large Mediator complex. This family includesthe C terminal region of a number of eukaryotic hypothetical proteins which are homologous to the Saccharomyces cerevisiae protein IWS1. IWS1 is known to be an Pol II transcription elongation factor and interacts with Spt6 and Spt5.


:

Pssm-ID: 462573 [Multi-domain]  Cd Length: 52  Bit Score: 38.27  E-value: 7.11e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 22328898    100 ALLEAVENLGVDSSKLVSSGLWVAVKKLVDH-GSSRVQDQARKLFGSWKD 148
Cdd:pfam08711    1 KLLKKLEKLPVTLELLKSTGIGKVVNKLRKHkENPEIKKLAKELVKKWKR 50
 
Name Accession Description Interval E-value
Med26 pfam08711
TFIIS helical bundle-like domain; Mediator is a large complex of up to 33 proteins that is ...
100-148 7.11e-04

TFIIS helical bundle-like domain; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species {1-2]. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. Notably, the 'small' and 'large' Mediator complexes differ in their subunit composition: the Med26 subunit preferentially associates with the small, active complex, whereas cdk8, cyclin C, Med12 and Med13 associate with the large Mediator complex. This family includesthe C terminal region of a number of eukaryotic hypothetical proteins which are homologous to the Saccharomyces cerevisiae protein IWS1. IWS1 is known to be an Pol II transcription elongation factor and interacts with Spt6 and Spt5.


Pssm-ID: 462573 [Multi-domain]  Cd Length: 52  Bit Score: 38.27  E-value: 7.11e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 22328898    100 ALLEAVENLGVDSSKLVSSGLWVAVKKLVDH-GSSRVQDQARKLFGSWKD 148
Cdd:pfam08711    1 KLLKKLEKLPVTLELLKSTGIGKVVNKLRKHkENPEIKKLAKELVKKWKR 50
 
Name Accession Description Interval E-value
Med26 pfam08711
TFIIS helical bundle-like domain; Mediator is a large complex of up to 33 proteins that is ...
100-148 7.11e-04

TFIIS helical bundle-like domain; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species {1-2]. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. Notably, the 'small' and 'large' Mediator complexes differ in their subunit composition: the Med26 subunit preferentially associates with the small, active complex, whereas cdk8, cyclin C, Med12 and Med13 associate with the large Mediator complex. This family includesthe C terminal region of a number of eukaryotic hypothetical proteins which are homologous to the Saccharomyces cerevisiae protein IWS1. IWS1 is known to be an Pol II transcription elongation factor and interacts with Spt6 and Spt5.


Pssm-ID: 462573 [Multi-domain]  Cd Length: 52  Bit Score: 38.27  E-value: 7.11e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 22328898    100 ALLEAVENLGVDSSKLVSSGLWVAVKKLVDH-GSSRVQDQARKLFGSWKD 148
Cdd:pfam08711    1 KLLKKLEKLPVTLELLKSTGIGKVVNKLRKHkENPEIKKLAKELVKKWKR 50
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH