NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1767281819|ref|NP_001361855|]
View 

G_PROTEIN_RECEP_F1_2 domain-containing protein [Caenorhabditis elegans]

Protein Classification

G protein-coupled receptor family protein( domain architecture ID 705710)

G protein-coupled receptor family protein is a seven-transmembrane G protein-coupled receptor (7TM-GPCR) family protein which typically transmits an extracellular signal into the cell by the conformational rearrangement of the 7TM helices and by the subsequent binding and activation of an intracellular heterotrimeric G protein; GPCR ligands include light-sensitive compounds, odors, pheromones, hormones, and neurotransmitters

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
1-98 6.28e-07

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member pfam10324:

Pssm-ID: 475119  Cd Length: 318  Bit Score: 50.28  E-value: 6.28e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1767281819   1 MFLALLRYLVMTYGTIRKT-FLS-PKDCWKLFILLILISSLITCFFNLKLEIVP-STKWRPPSSCTMYPANSTFPGFGTI 77
Cdd:pfam10324  97 VFMALIRTLVVKNPMSNKIqKLSkPKFGLIIIIIVFILSLPISIFYYFRYEIVEvGGIWKPPPNCAGFPPNYTETRYVLV 176
                          90       100
                  ....*....|....*....|..
gi 1767281819  78 QTDFYKDF-PEIFDIFTLFDGI 98
Cdd:pfam10324 177 VSELFTANdGLLLKIFLLIDGI 198
 
Name Accession Description Interval E-value
7TM_GPCR_Srw pfam10324
Serpentine type 7TM GPCR chemoreceptor Srw; Chemoreception is mediated in Caenorhabditis ...
1-98 6.28e-07

Serpentine type 7TM GPCR chemoreceptor Srw; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srw is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz.


Pssm-ID: 402097  Cd Length: 318  Bit Score: 50.28  E-value: 6.28e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1767281819   1 MFLALLRYLVMTYGTIRKT-FLS-PKDCWKLFILLILISSLITCFFNLKLEIVP-STKWRPPSSCTMYPANSTFPGFGTI 77
Cdd:pfam10324  97 VFMALIRTLVVKNPMSNKIqKLSkPKFGLIIIIIVFILSLPISIFYYFRYEIVEvGGIWKPPPNCAGFPPNYTETRYVLV 176
                          90       100
                  ....*....|....*....|..
gi 1767281819  78 QTDFYKDF-PEIFDIFTLFDGI 98
Cdd:pfam10324 177 VSELFTANdGLLLKIFLLIDGI 198
 
Name Accession Description Interval E-value
7TM_GPCR_Srw pfam10324
Serpentine type 7TM GPCR chemoreceptor Srw; Chemoreception is mediated in Caenorhabditis ...
1-98 6.28e-07

Serpentine type 7TM GPCR chemoreceptor Srw; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srw is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz.


Pssm-ID: 402097  Cd Length: 318  Bit Score: 50.28  E-value: 6.28e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1767281819   1 MFLALLRYLVMTYGTIRKT-FLS-PKDCWKLFILLILISSLITCFFNLKLEIVP-STKWRPPSSCTMYPANSTFPGFGTI 77
Cdd:pfam10324  97 VFMALIRTLVVKNPMSNKIqKLSkPKFGLIIIIIVFILSLPISIFYYFRYEIVEvGGIWKPPPNCAGFPPNYTETRYVLV 176
                          90       100
                  ....*....|....*....|..
gi 1767281819  78 QTDFYKDF-PEIFDIFTLFDGI 98
Cdd:pfam10324 177 VSELFTANdGLLLKIFLLIDGI 198
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH