NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1274095951|ref|NP_001344584|]
View 

uncharacterized protein LOC665828 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Cactin_mid super family cl10987
Conserved mid region of cactin; This is the conserved middle region of a family of proteins ...
1-33 1.62e-07

Conserved mid region of cactin; This is the conserved middle region of a family of proteins referred to as cactins. The region contains two of three predicted coiled-coil domains. Most members of this family have a CactinC_cactus pfam09732 domain at the C-terminal end. Upstream of Mid_cactin in Drosophila members are a serine-rich region, some non-typical RD motifs and three predicted bipartite nuclear localization signals, none of which are well-conserved. Cactin associates with IkappaB-cactus as one of the intracellular members of the Rel (NF-kappaB) pathway which is conserved in invertebrates and vertebrates. In mammals, this pathway controls the activities of the immune and inflammatory response genes as well as viral genes, and is critical for cell growth and survival. In Drosophila, the Rel pathway functions in the innate cellular and humoral immune response, in muscle development, and in the establishment of dorsal-ventral polarity in the early embryo.


The actual alignment was detected with superfamily member pfam10312:

Pssm-ID: 463049 [Multi-domain]  Cd Length: 186  Bit Score: 48.71  E-value: 1.62e-07
                          10        20        30
                  ....*....|....*....|....*....|....
gi 1274095951   1 MEDLLEDIQVHMELEQ-GKNVDFWQDSTTITENE 33
Cdd:pfam10312  78 LEELEEDIKTYLELEKdGKNREFWNAMLVVCEDE 111
 
Name Accession Description Interval E-value
Cactin_mid pfam10312
Conserved mid region of cactin; This is the conserved middle region of a family of proteins ...
1-33 1.62e-07

Conserved mid region of cactin; This is the conserved middle region of a family of proteins referred to as cactins. The region contains two of three predicted coiled-coil domains. Most members of this family have a CactinC_cactus pfam09732 domain at the C-terminal end. Upstream of Mid_cactin in Drosophila members are a serine-rich region, some non-typical RD motifs and three predicted bipartite nuclear localization signals, none of which are well-conserved. Cactin associates with IkappaB-cactus as one of the intracellular members of the Rel (NF-kappaB) pathway which is conserved in invertebrates and vertebrates. In mammals, this pathway controls the activities of the immune and inflammatory response genes as well as viral genes, and is critical for cell growth and survival. In Drosophila, the Rel pathway functions in the innate cellular and humoral immune response, in muscle development, and in the establishment of dorsal-ventral polarity in the early embryo.


Pssm-ID: 463049 [Multi-domain]  Cd Length: 186  Bit Score: 48.71  E-value: 1.62e-07
                          10        20        30
                  ....*....|....*....|....*....|....
gi 1274095951   1 MEDLLEDIQVHMELEQ-GKNVDFWQDSTTITENE 33
Cdd:pfam10312  78 LEELEEDIKTYLELEKdGKNREFWNAMLVVCEDE 111
 
Name Accession Description Interval E-value
Cactin_mid pfam10312
Conserved mid region of cactin; This is the conserved middle region of a family of proteins ...
1-33 1.62e-07

Conserved mid region of cactin; This is the conserved middle region of a family of proteins referred to as cactins. The region contains two of three predicted coiled-coil domains. Most members of this family have a CactinC_cactus pfam09732 domain at the C-terminal end. Upstream of Mid_cactin in Drosophila members are a serine-rich region, some non-typical RD motifs and three predicted bipartite nuclear localization signals, none of which are well-conserved. Cactin associates with IkappaB-cactus as one of the intracellular members of the Rel (NF-kappaB) pathway which is conserved in invertebrates and vertebrates. In mammals, this pathway controls the activities of the immune and inflammatory response genes as well as viral genes, and is critical for cell growth and survival. In Drosophila, the Rel pathway functions in the innate cellular and humoral immune response, in muscle development, and in the establishment of dorsal-ventral polarity in the early embryo.


Pssm-ID: 463049 [Multi-domain]  Cd Length: 186  Bit Score: 48.71  E-value: 1.62e-07
                          10        20        30
                  ....*....|....*....|....*....|....
gi 1274095951   1 MEDLLEDIQVHMELEQ-GKNVDFWQDSTTITENE 33
Cdd:pfam10312  78 LEELEEDIKTYLELEKdGKNREFWNAMLVVCEDE 111
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH