NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2154025536|gb|UFI00978|]
View 

transcription initiation factor TFIID subunit 7, partial [Homo sapiens]

Protein Classification

transcription initiation factor TFIID subunit 7 family protein( domain architecture ID 4530)

transcription initiation factor TFIID subunit 7 (TAF7) family protein is a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TAF7 super family cl04653
TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and ...
12-64 8.29e-17

TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex; The TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and are involved in forming the Transcription Factor IID (TFIID) complex. TFIID is one of seven General Transcription Factors (GTF) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) that are involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the preinitiation complex. TFIID complex is composed of the TBP and at least 13 TAFs. TAFs are named after their electrophoretic mobility in polyacrylamide gels in different species. A new, unified nomenclature has been suggested for the pol II TAFs to show the relationship between TAF orthologs and paralogs. Several hypotheses are proposed for TAFs functions such as serving as activator-binding sites, core-promoter recognition or a role in essential catalytic activity. Each TAF, with the help of a specific activator, is required only for expression of subset of genes and is not universally involved for transcription as are GTFs. TAF7 is involved in the regulation of the transition from PIC assembly to initiation and elongation. In yeast and human cells, TAFs have been found as components of other complexes besides TFIID. Several TAFs interact via histone-fold (HFD) motifs; the HFD is the interaction motif involved in heterodimerization of the core histones and their assembly into nucleosome octamers.


The actual alignment was detected with superfamily member pfam04658:

Pssm-ID: 471075  Cd Length: 160  Bit Score: 69.08  E-value: 8.29e-17
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 2154025536  12 LESQFILRLPPE-YASTVRRAVQSGHVnlKDRLTIELHPDGRHGIVRVDRVPLA 64
Cdd:pfam04658   1 IEEQFILRLPPDeDADYLRKAIESGDI--KDDLSIKFLKDGRRAVVRIGGQLYA 52
 
Name Accession Description Interval E-value
TAFII55_N pfam04658
TAFII55 protein conserved region; The general transcription factor, TFIID, consists of the ...
12-64 8.29e-17

TAFII55 protein conserved region; The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. TAFII55 binds to TAFII250 and inhibits it acetyltransferase activity. The exact role of TAFII55 is currently unknown. The conserved region is situated towards the N-terminus of the protein.


Pssm-ID: 461382  Cd Length: 160  Bit Score: 69.08  E-value: 8.29e-17
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 2154025536  12 LESQFILRLPPE-YASTVRRAVQSGHVnlKDRLTIELHPDGRHGIVRVDRVPLA 64
Cdd:pfam04658   1 IEEQFILRLPPDeDADYLRKAIESGDI--KDDLSIKFLKDGRRAVVRIGGQLYA 52
TAF7 cd08047
TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and ...
13-64 9.15e-15

TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex; The TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and are involved in forming the Transcription Factor IID (TFIID) complex. TFIID is one of seven General Transcription Factors (GTF) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) that are involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the preinitiation complex. TFIID complex is composed of the TBP and at least 13 TAFs. TAFs are named after their electrophoretic mobility in polyacrylamide gels in different species. A new, unified nomenclature has been suggested for the pol II TAFs to show the relationship between TAF orthologs and paralogs. Several hypotheses are proposed for TAFs functions such as serving as activator-binding sites, core-promoter recognition or a role in essential catalytic activity. Each TAF, with the help of a specific activator, is required only for expression of subset of genes and is not universally involved for transcription as are GTFs. TAF7 is involved in the regulation of the transition from PIC assembly to initiation and elongation. In yeast and human cells, TAFs have been found as components of other complexes besides TFIID. Several TAFs interact via histone-fold (HFD) motifs; the HFD is the interaction motif involved in heterodimerization of the core histones and their assembly into nucleosome octamers.


Pssm-ID: 173966  Cd Length: 162  Bit Score: 63.83  E-value: 9.15e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 2154025536  13 ESQFILRLPPEYASTVRRAVQSGHVNLKDrLTIELHPDGRHGIVRVDRVPLA 64
Cdd:cd08047     1 EEQFILRLPPDVADRLRKAIEEGDSNEKL-LSITLFEDSRRAVVRINGQKYP 51
 
Name Accession Description Interval E-value
TAFII55_N pfam04658
TAFII55 protein conserved region; The general transcription factor, TFIID, consists of the ...
12-64 8.29e-17

TAFII55 protein conserved region; The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. TAFII55 binds to TAFII250 and inhibits it acetyltransferase activity. The exact role of TAFII55 is currently unknown. The conserved region is situated towards the N-terminus of the protein.


Pssm-ID: 461382  Cd Length: 160  Bit Score: 69.08  E-value: 8.29e-17
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 2154025536  12 LESQFILRLPPE-YASTVRRAVQSGHVnlKDRLTIELHPDGRHGIVRVDRVPLA 64
Cdd:pfam04658   1 IEEQFILRLPPDeDADYLRKAIESGDI--KDDLSIKFLKDGRRAVVRIGGQLYA 52
TAF7 cd08047
TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and ...
13-64 9.15e-15

TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex; The TATA Binding Protein (TBP) Associated Factor 7 (TAF7) is one of several TAFs that bind TBP and are involved in forming the Transcription Factor IID (TFIID) complex. TFIID is one of seven General Transcription Factors (GTF) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) that are involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the preinitiation complex. TFIID complex is composed of the TBP and at least 13 TAFs. TAFs are named after their electrophoretic mobility in polyacrylamide gels in different species. A new, unified nomenclature has been suggested for the pol II TAFs to show the relationship between TAF orthologs and paralogs. Several hypotheses are proposed for TAFs functions such as serving as activator-binding sites, core-promoter recognition or a role in essential catalytic activity. Each TAF, with the help of a specific activator, is required only for expression of subset of genes and is not universally involved for transcription as are GTFs. TAF7 is involved in the regulation of the transition from PIC assembly to initiation and elongation. In yeast and human cells, TAFs have been found as components of other complexes besides TFIID. Several TAFs interact via histone-fold (HFD) motifs; the HFD is the interaction motif involved in heterodimerization of the core histones and their assembly into nucleosome octamers.


Pssm-ID: 173966  Cd Length: 162  Bit Score: 63.83  E-value: 9.15e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
gi 2154025536  13 ESQFILRLPPEYASTVRRAVQSGHVNLKDrLTIELHPDGRHGIVRVDRVPLA 64
Cdd:cd08047     1 EEQFILRLPPDVADRLRKAIEEGDSNEKL-LSITLFEDSRRAVVRINGQKYP 51
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH