NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|42567043|ref|NP_194017|]
View 

Cell cycle regulated microtubule associated protein [Arabidopsis thaliana]

Protein Classification

TPX2_importin domain-containing protein( domain architecture ID 10573584)

TPX2_importin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
TPX2_importin pfam12214
Cell cycle regulated microtubule associated protein; This domain is found in eukaryotes. This ...
 257-415 8.02e-55

Cell cycle regulated microtubule associated protein; This domain is found in eukaryotes. This domain is typically between 127 to 182 amino acids in length. This domain is found associated with pfam06886. This domain is found in the protein TPX2 (a.k.a p100) which is involved in cell cycling. It is only expressed between the start of the S phase and completion of cytokinesis. The microtubule-associated protein TPX2 has been reported to be crucial for mitotic spindle formation. This domain is close to the C terminal of TPX2. The protein importin alpha regulates the activity of TPX2 by binding to the nuclear localization signal in this domain.


:

Pssm-ID: 463495 [Multi-domain]  Cd Length: 129  Bit Score: 180.19  E-value: 8.02e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42567043   257 PQEPDFATSQRAHRIRHKNDAKLEQEQPA---VYRFKARPFNRKIFDAPSLPIRKKSTPKLPEFQEFHLKTSERAMQHSS 333
Cdd:pfam12214   1 PKEPELETAQRARPVRVKSSAELEAEELEkiqQYKFKARPLNRKILEAPSLPLKKPSTPRLTEFQEFHLETEKRAQQRSS 80

                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42567043   334 AVTTRshaykesdksiitdmldgdnresrrpsgmdiskHDVSEGSHVFKARPLNKKILSSRGDMGIFKNSKRETTVPLEF 413
Cdd:pfam12214  81 KKSTS---------------------------------EEELEKKHKFKARPLNKKILESKGVVGVFEKKKLPTTVPKEP 127


                  ..
gi 42567043   414 SF 415
Cdd:pfam12214 128 AF 129
 
Name Accession Description Interval E-value
TPX2_importin pfam12214
Cell cycle regulated microtubule associated protein; This domain is found in eukaryotes. This ...
 257-415 8.02e-55

Cell cycle regulated microtubule associated protein; This domain is found in eukaryotes. This domain is typically between 127 to 182 amino acids in length. This domain is found associated with pfam06886. This domain is found in the protein TPX2 (a.k.a p100) which is involved in cell cycling. It is only expressed between the start of the S phase and completion of cytokinesis. The microtubule-associated protein TPX2 has been reported to be crucial for mitotic spindle formation. This domain is close to the C terminal of TPX2. The protein importin alpha regulates the activity of TPX2 by binding to the nuclear localization signal in this domain.


Pssm-ID: 463495 [Multi-domain]  Cd Length: 129  Bit Score: 180.19  E-value: 8.02e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42567043   257 PQEPDFATSQRAHRIRHKNDAKLEQEQPA---VYRFKARPFNRKIFDAPSLPIRKKSTPKLPEFQEFHLKTSERAMQHSS 333
Cdd:pfam12214   1 PKEPELETAQRARPVRVKSSAELEAEELEkiqQYKFKARPLNRKILEAPSLPLKKPSTPRLTEFQEFHLETEKRAQQRSS 80

                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42567043   334 AVTTRshaykesdksiitdmldgdnresrrpsgmdiskHDVSEGSHVFKARPLNKKILSSRGDMGIFKNSKRETTVPLEF 413
Cdd:pfam12214  81 KKSTS---------------------------------EEELEKKHKFKARPLNKKILESKGVVGVFEKKKLPTTVPKEP 127


                  ..
gi 42567043   414 SF 415
Cdd:pfam12214 128 AF 129
 
Name Accession Description Interval E-value
TPX2_importin pfam12214
Cell cycle regulated microtubule associated protein; This domain is found in eukaryotes. This ...
 257-415 8.02e-55

Cell cycle regulated microtubule associated protein; This domain is found in eukaryotes. This domain is typically between 127 to 182 amino acids in length. This domain is found associated with pfam06886. This domain is found in the protein TPX2 (a.k.a p100) which is involved in cell cycling. It is only expressed between the start of the S phase and completion of cytokinesis. The microtubule-associated protein TPX2 has been reported to be crucial for mitotic spindle formation. This domain is close to the C terminal of TPX2. The protein importin alpha regulates the activity of TPX2 by binding to the nuclear localization signal in this domain.


Pssm-ID: 463495 [Multi-domain]  Cd Length: 129  Bit Score: 180.19  E-value: 8.02e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42567043   257 PQEPDFATSQRAHRIRHKNDAKLEQEQPA---VYRFKARPFNRKIFDAPSLPIRKKSTPKLPEFQEFHLKTSERAMQHSS 333
Cdd:pfam12214   1 PKEPELETAQRARPVRVKSSAELEAEELEkiqQYKFKARPLNRKILEAPSLPLKKPSTPRLTEFQEFHLETEKRAQQRSS 80

                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42567043   334 AVTTRshaykesdksiitdmldgdnresrrpsgmdiskHDVSEGSHVFKARPLNKKILSSRGDMGIFKNSKRETTVPLEF 413
Cdd:pfam12214  81 KKSTS---------------------------------EEELEKKHKFKARPLNKKILESKGVVGVFEKKKLPTTVPKEP 127


                  ..
gi 42567043   414 SF 415
Cdd:pfam12214 128 AF 129
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH