NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|222642143|gb|EEE70275|]
View 

hypothetical protein OsJ_30424 [Oryza sativa Japonica Group]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
ACT_ACR-like_3 cd04896
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 303-377 6.65e-46

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


:

Pssm-ID: 153168  Cd Length: 75  Bit Score: 154.16  E-value: 6.65e-46
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 222642143 303 TLIQIQCGDHKGLVYDIMRTLKDCNIQISYGRFYASQNGSCEVDLFAVQSDGKKIVDQHKQRALCCRLRTELHRP 377
Cdd:cd04896    1 TLLQIRCVDQKGLLYDILRTSKDCNIQISYGRFSSKVKGYREVDLFIVQSDGKKIMDPKKQAALCARLREEMVCP 75
ACT_ACR-like_1 cd04894
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 23-92 2.58e-40

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the N-terminal ACT domain of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


:

Pssm-ID: 153166  Cd Length: 69  Bit Score: 139.19  E-value: 2.58e-40
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143  23 TVVTISCPDKTGLGCDLCRLVLLFGLNIVKGDMSTDGRWCYIVLWVVARPGRaMAMRWDLLKDRLIQLCP 92
Cdd:cd04894    1 SVITINCPDKTGLGCDLCRIILEFGLNITRGDDSTDGRWCYIVFWVVPRPPS-IKVRWDLLKNRLMSACP 69
ACT_ACR-like_4 cd04898
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 395-467 1.10e-38

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


:

Pssm-ID: 153170  Cd Length: 77  Bit Score: 135.07  E-value: 1.10e-38
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 222642143 395 NPVEVSGKGRPLVFYDITLALKKLHKRIFLAEIGRHVVGDREWEVYRVHLGEGD----HSSLRSKIVDGVTNMLMGW 467
Cdd:cd04898    1 NPVELSGKGRPRVFYDITLALKKLGICIFSAEIGRHSTGDRQWEVYRVLLLEHDrlklGGRQRSKVVDRVTKTLMGW 77
ACT super family cl09141
ACT domains are commonly involved in specifically binding an amino acid or other small ligand ...
 124-245 6.56e-09

ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme; Members of this CD belong to the superfamily of ACT regulatory domains. Pairs of ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain has been detected in a number of diverse proteins; some of these proteins are involved in amino acid and purine biosynthesis, phenylalanine hydroxylation, regulation of bacterial metabolism and transcription, and many remain to be characterized. ACT domain-containing enzymes involved in amino acid and purine synthesis are in many cases allosteric enzymes with complex regulation enforced by the binding of ligands. The ACT domain is commonly involved in the binding of a small regulatory molecule, such as the amino acids L-Ser and L-Phe in the case of D-3-phosphoglycerate dehydrogenase and the bifunctional chorismate mutase-prephenate dehydratase enzyme (P-protein), respectively. Aspartokinases typically consist of two C-terminal ACT domains in a tandem repeat, but the second ACT domain is inserted within the first, resulting in, what is normally the terminal beta strand of ACT2, formed from a region N-terminal of ACT1. ACT domain repeats have been shown to have nonequivalent ligand-binding sites with complex regulatory patterns such as those seen in the bifunctional enzyme, aspartokinase-homoserine dehydrogenase (ThrA). In other enzymes, such as phenylalanine hydroxylases, the ACT domain appears to function as a flexible small module providing allosteric regulation via transmission of conformational changes, these conformational changes are not necessarily initiated by regulatory ligand binding at the ACT domain itself. ACT domains are present either singularly, N- or C-terminal, or in pairs present C-terminal or between two catalytic domains. Unique to cyanobacteria are four ACT domains C-terminal to an aspartokinase domain. A few proteins are composed almost entirely of ACT domain repeats as seen in the four ACT domain protein, the ACR protein, found in higher plants; and the two ACT domain protein, the glycine cleavage system transcriptional repressor (GcvR) protein, found in some bacteria. Also seen are single ACT domain proteins similar to the Streptococcus pneumoniae ACT domain protein (uncharacterized pdb structure 1ZPV) found in both bacteria and archaea. Purportedly, the ACT domain is an evolutionarily mobile ligand binding regulatory module that has been fused to different enzymes at various times.


The actual alignment was detected with superfamily member cd04927:

Pssm-ID: 471857  Cd Length: 76  Bit Score: 52.47  E-value: 6.56e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143 124 FLLKFFCYDRMGLLHEskekekgilvgsraiaiamalnrFTQWLRPEELSLEaraadgrrppraasRSSCGATvgmPEar 203
Cdd:cd04927    1 FLLKLFCSDRKGLLHD-----------------------VTEVLYELELTIE--------------RVKVSTT---PD-- 38

                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 222642143 204 gqraerqhqrwGEQMDV-------ELLHTKSRREETYDKLQSVLGDSLT 245
Cdd:cd04927   39 -----------GRVLDLffitdarELLHTKKRREETYDYLRAVLGDSMI 76
 
Name Accession Description Interval E-value
ACT_ACR-like_3 cd04896
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 303-377 6.65e-46

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153168  Cd Length: 75  Bit Score: 154.16  E-value: 6.65e-46
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 222642143 303 TLIQIQCGDHKGLVYDIMRTLKDCNIQISYGRFYASQNGSCEVDLFAVQSDGKKIVDQHKQRALCCRLRTELHRP 377
Cdd:cd04896    1 TLLQIRCVDQKGLLYDILRTSKDCNIQISYGRFSSKVKGYREVDLFIVQSDGKKIMDPKKQAALCARLREEMVCP 75
ACT_ACR-like_1 cd04894
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 23-92 2.58e-40

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the N-terminal ACT domain of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153166  Cd Length: 69  Bit Score: 139.19  E-value: 2.58e-40
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143  23 TVVTISCPDKTGLGCDLCRLVLLFGLNIVKGDMSTDGRWCYIVLWVVARPGRaMAMRWDLLKDRLIQLCP 92
Cdd:cd04894    1 SVITINCPDKTGLGCDLCRIILEFGLNITRGDDSTDGRWCYIVFWVVPRPPS-IKVRWDLLKNRLMSACP 69
ACT_ACR-like_4 cd04898
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 395-467 1.10e-38

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153170  Cd Length: 77  Bit Score: 135.07  E-value: 1.10e-38
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 222642143 395 NPVEVSGKGRPLVFYDITLALKKLHKRIFLAEIGRHVVGDREWEVYRVHLGEGD----HSSLRSKIVDGVTNMLMGW 467
Cdd:cd04898    1 NPVELSGKGRPRVFYDITLALKKLGICIFSAEIGRHSTGDRQWEVYRVLLLEHDrlklGGRQRSKVVDRVTKTLMGW 77
ACT_ACR-like_2 cd04927
Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost ...
 124-245 6.56e-09

Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153199  Cd Length: 76  Bit Score: 52.47  E-value: 6.56e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143 124 FLLKFFCYDRMGLLHEskekekgilvgsraiaiamalnrFTQWLRPEELSLEaraadgrrppraasRSSCGATvgmPEar 203
Cdd:cd04927    1 FLLKLFCSDRKGLLHD-----------------------VTEVLYELELTIE--------------RVKVSTT---PD-- 38

                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 222642143 204 gqraerqhqrwGEQMDV-------ELLHTKSRREETYDKLQSVLGDSLT 245
Cdd:cd04927   39 -----------GRVLDLffitdarELLHTKKRREETYDYLRAVLGDSMI 76
PRK05092 PRK05092
PII uridylyl-transferase; Provisional
 291-371 1.20e-05

PII uridylyl-transferase; Provisional


Pssm-ID: 235342 [Multi-domain]  Cd Length: 931  Bit Score: 47.94  E-value: 1.20e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143 291 SVAMDNSLSPAHTLIQIQCGDHKGLVYDIMRTLKDCNIQIS------YGR-----FYASqngscevDLFavqsdGKKIVD 359
Cdd:PRK05092 832 RVTIDNEASNRFTVIEVNGRDRPGLLYDLTRALSDLNLNIAsahiatYGEravdvFYVT-------DLF-----GLKITN 899

                         90
                 ....*....|..
gi 222642143 360 QHKQRALCCRLR 371
Cdd:PRK05092 900 EARQAAIRRALL 911
 
Name Accession Description Interval E-value
ACT_ACR-like_3 cd04896
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 303-377 6.65e-46

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153168  Cd Length: 75  Bit Score: 154.16  E-value: 6.65e-46
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 222642143 303 TLIQIQCGDHKGLVYDIMRTLKDCNIQISYGRFYASQNGSCEVDLFAVQSDGKKIVDQHKQRALCCRLRTELHRP 377
Cdd:cd04896    1 TLLQIRCVDQKGLLYDILRTSKDCNIQISYGRFSSKVKGYREVDLFIVQSDGKKIMDPKKQAALCARLREEMVCP 75
ACT_ACR-like_1 cd04894
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 23-92 2.58e-40

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the N-terminal ACT domain of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153166  Cd Length: 69  Bit Score: 139.19  E-value: 2.58e-40
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143  23 TVVTISCPDKTGLGCDLCRLVLLFGLNIVKGDMSTDGRWCYIVLWVVARPGRaMAMRWDLLKDRLIQLCP 92
Cdd:cd04894    1 SVITINCPDKTGLGCDLCRIILEFGLNITRGDDSTDGRWCYIVFWVVPRPPS-IKVRWDLLKNRLMSACP 69
ACT_ACR-like_4 cd04898
ACT domain-containing protein which is composed almost entirely of four ACT domain repeats ...
 395-467 1.10e-38

ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153170  Cd Length: 77  Bit Score: 135.07  E-value: 1.10e-38
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 222642143 395 NPVEVSGKGRPLVFYDITLALKKLHKRIFLAEIGRHVVGDREWEVYRVHLGEGD----HSSLRSKIVDGVTNMLMGW 467
Cdd:cd04898    1 NPVELSGKGRPRVFYDITLALKKLGICIFSAEIGRHSTGDRQWEVYRVLLLEHDrlklGGRQRSKVVDRVTKTLMGW 77
ACT_UUR-ACR-like cd04873
ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) ...
 23-91 1.51e-12

ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; This ACT domain family, ACT_UUR_ACR-like, includes the two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the four ACT domains of a novel protein composed almost entirely of ACT domain repeats (the ACR protein) and like proteins. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. This CD also includes the first of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein and related domains, as well as, the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted tyrosine kinase. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153145 [Multi-domain]  Cd Length: 70  Bit Score: 62.57  E-value: 1.51e-12
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143  23 TVVTISCPDKTGLGCDLCRLVLLFGLNIVKGDMSTDGRWCYIVLWVVARPGRAMAM-RWDLLKDRLIQLC 91
Cdd:cd04873    1 TVVEVYAPDRPGLLADITRVLADLGLNIHDARISTTGERALDVFYVTDSDGRPLDPeRIARLEEALEDAL 70
ACT_UUR-ACR-like cd04873
ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) ...
 303-374 7.51e-11

ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; This ACT domain family, ACT_UUR_ACR-like, includes the two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the four ACT domains of a novel protein composed almost entirely of ACT domain repeats (the ACR protein) and like proteins. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. This CD also includes the first of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein and related domains, as well as, the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted tyrosine kinase. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153145 [Multi-domain]  Cd Length: 70  Bit Score: 57.94  E-value: 7.51e-11
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 222642143 303 TLIQIQCGDHKGLVYDIMRTLKDCNIQISYGRFYASqnGSCEVDLFAVQSDGKKIVDQHKQRALCCRLRTEL 374
Cdd:cd04873    1 TVVEVYAPDRPGLLADITRVLADLGLNIHDARISTT--GERALDVFYVTDSDGRPLDPERIARLEEALEDAL 70
ACT_ACR-like_2 cd04927
Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost ...
 124-245 6.56e-09

Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein); This CD includes the second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153199  Cd Length: 76  Bit Score: 52.47  E-value: 6.56e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143 124 FLLKFFCYDRMGLLHEskekekgilvgsraiaiamalnrFTQWLRPEELSLEaraadgrrppraasRSSCGATvgmPEar 203
Cdd:cd04927    1 FLLKLFCSDRKGLLHD-----------------------VTEVLYELELTIE--------------RVKVSTT---PD-- 38

                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 222642143 204 gqraerqhqrwGEQMDV-------ELLHTKSRREETYDKLQSVLGDSLT 245
Cdd:cd04927   39 -----------GRVLDLffitdarELLHTKKRREETYDYLRAVLGDSMI 76
PRK05092 PRK05092
PII uridylyl-transferase; Provisional
 291-371 1.20e-05

PII uridylyl-transferase; Provisional


Pssm-ID: 235342 [Multi-domain]  Cd Length: 931  Bit Score: 47.94  E-value: 1.20e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143 291 SVAMDNSLSPAHTLIQIQCGDHKGLVYDIMRTLKDCNIQIS------YGR-----FYASqngscevDLFavqsdGKKIVD 359
Cdd:PRK05092 832 RVTIDNEASNRFTVIEVNGRDRPGLLYDLTRALSDLNLNIAsahiatYGEravdvFYVT-------DLF-----GLKITN 899

                         90
                 ....*....|..
gi 222642143 360 QHKQRALCCRLR 371
Cdd:PRK05092 900 EARQAAIRRALL 911
ACT_UUR-ACR-like cd04873
ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) ...
 397-464 1.22e-05

ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; This ACT domain family, ACT_UUR_ACR-like, includes the two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the four ACT domains of a novel protein composed almost entirely of ACT domain repeats (the ACR protein) and like proteins. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. This CD also includes the first of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein and related domains, as well as, the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted tyrosine kinase. Members of this CD belong to the superfamily of ACT regulatory domains.


Pssm-ID: 153145 [Multi-domain]  Cd Length: 70  Bit Score: 42.92  E-value: 1.22e-05
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222642143 397 VEVSGKGRPLVFYDITLALKKLHKRIFLAEIgrHVVGDREWEVYRVHLGEG--DHSSLRSKIVDGVTNML 464
Cdd:cd04873    3 VEVYAPDRPGLLADITRVLADLGLNIHDARI--STTGERALDVFYVTDSDGrpLDPERIARLEEALEDAL 70
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH