NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|385283635|gb|AFI58261|]
View 

endothelin receptor B1, partial [Plecodus paradoxus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
1-56 6.65e-33

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15976:

Pssm-ID: 475119 [Multi-domain]  Cd Length: 296  Bit Score: 113.41  E-value: 6.65e-33
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 385283635   1 GVQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 56
Cdd:cd15976  205 GMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 260
 
Name Accession Description Interval E-value
7tmA_ET-BR cd15976
endothelin B receptor, member of the class A family of seven-transmembrane G protein-coupled ...
1-56 6.65e-33

endothelin B receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Endothelins are able to activate a number of signal transduction processes including phospholipase A2, phospholipase C, and phospholipase D, as well as cytosolic protein kinase activation. They play an important role in the regulation of the cardiovascular system and are the most potent vasoconstrictors identified, stimulating cardiac contraction, regulating the release of vasoactive substances, and stimulating mitogenesis in blood vessels. Two endothelin receptor subtypes have been isolated and identified in vertebrates, endothelin A receptor (ET-A) and endothelin B receptor (ET-B), and are members of the seven transmembrane class A G-protein coupled receptor family which activate multiple effectors via different types of G protein. Some vertebrates contain a third subtype, endothelin A receptor (ET-C). ET-A receptors are mainly located on vascular smooth muscle cells, whereas ET-B receptors are present on endothelial cells lining the vessel wall. Endothelin receptors have also been found in the brain.


Pssm-ID: 320642 [Multi-domain]  Cd Length: 296  Bit Score: 113.41  E-value: 6.65e-33
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 385283635   1 GVQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 56
Cdd:cd15976  205 GMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 260
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
11-51 4.97e-04

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 35.35  E-value: 4.97e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 385283635   11 KQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPN 51
Cdd:pfam00001 192 QRRRKALKTLAVVVVVFILCWLPYHIVNLLDSLALDCELSR 232
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
11-40 5.12e-03

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 32.44  E-value: 5.12e-03
                         10        20        30
                 ....*....|....*....|....*....|
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:PHA03087 237 KKNKKAIKLVLIIVILFVIFWLPFNVSVFV 266
 
Name Accession Description Interval E-value
7tmA_ET-BR cd15976
endothelin B receptor, member of the class A family of seven-transmembrane G protein-coupled ...
1-56 6.65e-33

endothelin B receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Endothelins are able to activate a number of signal transduction processes including phospholipase A2, phospholipase C, and phospholipase D, as well as cytosolic protein kinase activation. They play an important role in the regulation of the cardiovascular system and are the most potent vasoconstrictors identified, stimulating cardiac contraction, regulating the release of vasoactive substances, and stimulating mitogenesis in blood vessels. Two endothelin receptor subtypes have been isolated and identified in vertebrates, endothelin A receptor (ET-A) and endothelin B receptor (ET-B), and are members of the seven transmembrane class A G-protein coupled receptor family which activate multiple effectors via different types of G protein. Some vertebrates contain a third subtype, endothelin A receptor (ET-C). ET-A receptors are mainly located on vascular smooth muscle cells, whereas ET-B receptors are present on endothelial cells lining the vessel wall. Endothelin receptors have also been found in the brain.


Pssm-ID: 320642 [Multi-domain]  Cd Length: 296  Bit Score: 113.41  E-value: 6.65e-33
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 385283635   1 GVQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 56
Cdd:cd15976  205 GMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 260
7tmA_ET_R cd15128
endothelin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
2-56 1.82e-30

endothelin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Endothelins are 21-amino acid peptides which able to activate a number of signal transduction processes including phospholipase A2, phospholipase C, and phospholipase D, as well as cytosolic protein kinase activation. They play an important role in the regulation of the cardiovascular system and are the most potent vasoconstrictors identified, stimulating cardiac contraction, regulating the release of vasoactive substances, and stimulating mitogenesis in blood vessels. Two endothelin receptor subtypes have been isolated and identified in vertebrates, endothelin A receptor (ET-A) and endothelin B receptor (ET-B), and are members of the seven transmembrane class A G-protein coupled receptor family which activate multiple effectors via different types of G protein. Some vertebrates contain a third subtype, endothelin A receptor (ET-C). ET-A receptors are mainly located on vascular smooth muscle cells, whereas ET-B receptors are present on endothelial cells lining the vessel wall. Endothelin receptors have also been found in the brain.


Pssm-ID: 320256 [Multi-domain]  Cd Length: 300  Bit Score: 107.22  E-value: 1.82e-30
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 385283635   2 VQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 56
Cdd:cd15128  210 LRIALNEHLKQRREVAKTVFCLVVIFALCWLPLHLSRILKLTVYDQNDPNRCELL 264
7tmA_ET-CR cd15977
endothelin C receptor, member of the class A family of seven-transmembrane G protein-coupled ...
1-56 1.33e-28

endothelin C receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Endothelins are able to activate a number of signal transduction processes including phospholipase A2, phospholipase C, and phospholipase D, as well as cytosolic protein kinase activation. They play an important role in the regulation of the cardiovascular system and are the most potent vasoconstrictors identified, stimulating cardiac contraction, regulating the release of vasoactive substances, and stimulating mitogenesis in blood vessels. Two endothelin receptor subtypes have been isolated and identified in vertebrates, endothelin A receptor (ET-A) and endothelin B receptor (ET-B), and are members of the seven transmembrane class A G-protein coupled receptor family which activate multiple effectors via different types of G protein. Some vertebrates contain a third subtype, endothelin A receptor (ET-C). ET-A receptors are mainly located on vascular smooth muscle cells, whereas ET-B receptors are present on endothelial cells lining the vessel wall. Endothelin receptors have also been found in the brain. The ET-C receptor is specific for endothelin-3 on frog dermal melanophores; its activation causes dispersion of pigment granules.


Pssm-ID: 320643 [Multi-domain]  Cd Length: 296  Bit Score: 102.29  E-value: 1.33e-28
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 385283635   1 GVQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 56
Cdd:cd15977  205 GMRIALNDHMKQRREVAKTVFCLVVIFALCWLPLHLSRILKKTIYDVKDPQRCELL 260
7tmA_ET-AR cd15975
endothelin A (or endothelin-1) receptor, member of the class A family of seven-transmembrane G ...
2-56 3.48e-28

endothelin A (or endothelin-1) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Endothelins are able to activate a number of signal transduction processes including phospholipase A2, phospholipase C, and phospholipase D, as well as cytosolic protein kinase activation. They play an important role in the regulation of the cardiovascular system and are the most potent vasoconstrictors identified, stimulating cardiac contraction, regulating the release of vasoactive substances, and stimulating mitogenesis in blood vessels. Two endothelin receptor subtypes have been isolated and identified in vertebrates, endothelin A receptor (ET-A) and endothelin B receptor (ET-B), and are members of the seven transmembrane class A G-protein coupled receptor family which activate multiple effectors via different types of G protein. Some vertebrates contain a third subtype, endothelin A receptor (ET-C). ET-A receptors are mainly located on vascular smooth muscle cells, whereas ET-B receptors are present on endothelial cells lining the vessel wall. Endothelin receptors have also been found in the brain.


Pssm-ID: 320641 [Multi-domain]  Cd Length: 300  Bit Score: 101.09  E-value: 3.48e-28
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 385283635   2 VQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRCELL 56
Cdd:cd15975  210 LRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNENDPRRCELL 264
7tmA_ET_R-like cd14977
endothelin receptors and related proteins, member of the class A family of seven-transmembrane ...
1-47 3.65e-15

endothelin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes endothelin receptors, bombesin receptor subtype 3 (BRS-3), gastrin-releasing peptide receptor (GRPR), neuromedin B receptor (NMB-R), endothelin B receptor-like 2 (ETBR-LP-2), and GRP37. The endothelin receptors and related proteins are members of the seven transmembrane rhodopsin-like G-protein coupled receptor family (class A GPCRs) which activate multiple effectors via different types of G protein.


Pssm-ID: 320108 [Multi-domain]  Cd Length: 292  Bit Score: 66.29  E-value: 3.65e-15
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 385283635   1 GVQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDE 47
Cdd:cd14977  204 EYTRGTKKHMKQRRQLAKTVLCLVLVFAFCWLPEHISNILRATLYNE 250
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
9-40 3.75e-07

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 44.13  E-value: 3.75e-07
                         10        20        30
                 ....*....|....*....|....*....|..
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd14993  217 ILRSKKKVARMLIVVVVLFALSWLPYYVLSIL 248
7tmA_Bombesin_R-like cd15927
bombesin receptor subfamily, member of the class A family of seven-transmembrane G ...
1-36 3.00e-06

bombesin receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; This bombesin subfamily of G-protein coupled receptors consists of neuromedin B receptor (NMBR), gastrin-releasing peptide receptor (GRPR), and bombesin receptor subtype 3 (BRS-3). Bombesin is a tetradecapeptide, originally isolated from frog skin. Mammalian bombesin-related peptides are widely distributed in the gastrointestinal and central nervous systems. The bombesin family receptors couple mainly to the G proteins of G(q/11) family. NMBR functions as the receptor for the neuropeptide neuromedin B, a potent mitogen and growth factor for normal and cancerous lung and for gastrointestinal epithelial tissues. Gastrin-releasing peptide is an endogenous ligand for GRPR and shares high sequence homology with NMB in the C-terminal region. Both NMB and GRP possess bombesin-like biochemical properties. BRS-3 is classified as an orphan receptor and suggested to play a role in sperm cell division and maturation. BRS-3 interacts with known naturally-occurring bombesin-related peptides with low affinity; however, no endogenous high-affinity ligand to the receptor has been identified. The bombesin receptor family belongs to the seven transmembrane rhodopsin-like G-protein coupled receptors (class A GPCRs), which perceive extracellular signals and transduce them to guanine nucleotide-binding (G) proteins.


Pssm-ID: 320593 [Multi-domain]  Cd Length: 294  Bit Score: 41.48  E-value: 3.00e-06
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 385283635   1 GVQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHL 36
Cdd:cd15927  207 GQNQAAQRQIEARKKVAKTVLAFVVLFAVCWLPRHV 242
7tmA_KiSS1R cd15095
KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of ...
9-36 8.09e-06

KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled KiSS1-derived peptide receptor (GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (previously known as metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. The KiSS1 receptor is coupled to G proteins of the G(q/11) family, which lead to activation of phospholipase C and increase of intracellular calcium. This signaling cascade plays an important role in reproduction by regulating the secretion of gonadotropin-releasing hormone.


Pssm-ID: 320223 [Multi-domain]  Cd Length: 288  Bit Score: 40.34  E-value: 8.09e-06
                         10        20
                 ....*....|....*....|....*...
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHL 36
Cdd:cd15095  211 ALRQKRKVTRMVIVVVVLFAICWLPNHV 238
7tmA_SKR_NK2R cd16004
substance-K receptor, member of the class A family of seven-transmembrane G protein-coupled ...
9-48 8.09e-06

substance-K receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The substance-K receptor (SKR), also known as tachykinin receptor 2 (TACR2) or neurokinin A receptor or NK2R, is a G-protein coupled receptor that specifically binds to neurokinin A. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception.


Pssm-ID: 320670 [Multi-domain]  Cd Length: 285  Bit Score: 40.60  E-value: 8.09e-06
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRIL---KLTIYDEK 48
Cdd:cd16004  208 QLQAKKKFVKTMVVVVVTFAICWLPYHLYFILgsfNEDIYCQK 250
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
9-40 9.11e-06

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 40.35  E-value: 9.11e-06
                         10        20        30
                 ....*....|....*....|....*....|..
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd00637  207 RRRRERKVTKTLLIVVVVFLLCWLPYFILLLL 238
7tmA_NMU-R cd15133
neuromedin U receptors, member of the class A family of seven-transmembrane G protein-coupled ...
6-40 1.00e-05

neuromedin U receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuromedin U (NMU) is a highly conserved neuropeptide with a common C-terminal heptapeptide sequence (FLFRPRN-amide) found at the highest levels in the gastrointestinal tract and pituitary gland of mammals. Disruption or replacement of residues in the conserved heptapeptide region can result in the reduced ability of NMU to stimulate smooth-muscle contraction. Two G-protein coupled receptor subtypes, NMU-R1 and NMU-R2, with a distinct expression pattern, have been identified to bind NMU. NMU-R1 is expressed primarily in the peripheral nervous system, while NMU-R2 is mainly found in the central nervous system. Neuromedin S, a 36 amino-acid neuropeptide that shares a conserved C-terminal heptapeptide sequence with NMU, is a highly potent and selective NMU-R2 agonist. Pharmacological studies have shown that both NMU and NMS inhibit food intake and reduce body weight, and that NMU increases energy expenditure.


Pssm-ID: 320261 [Multi-domain]  Cd Length: 298  Bit Score: 40.21  E-value: 1.00e-05
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 385283635   6 LSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15133  216 LLQHPRTRAQVTKMLFILVVVFAICWAPFHIDRLM 250
7tmA_NMU-R1 cd15358
neuromedin U receptor subtype 1, member of the class A family of seven-transmembrane G ...
4-50 1.07e-05

neuromedin U receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuromedin U (NMU) is a highly conserved neuropeptide with a common C-terminal heptapeptide sequence (FLFRPRN-amide) found at the highest levels in the gastrointestinal tract and pituitary gland of mammals. Disruption or replacement of residues in the conserved heptapeptide region can result in the reduced ability of NMU to stimulate smooth-muscle contraction. Two G-protein coupled receptor subtypes, NMU-R1 and NMU-R2, with a distinct expression pattern, have been identified to bind NMU. NMU-R1 is expressed primarily in the peripheral nervous system, while NMU-R2 is mainly found in the central nervous system. Neuromedin S, a 36 amino-acid neuropeptide that shares a conserved C-terminal heptapeptide sequence with NMU, is a highly potent and selective NMU-R2 agonist. Pharmacological studies have shown that both NMU and NMS inhibit food intake and reduce body weight, and that NMU increases energy expenditure.


Pssm-ID: 320480 [Multi-domain]  Cd Length: 305  Bit Score: 40.14  E-value: 1.07e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 385283635   4 IALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDP 50
Cdd:cd15358  221 RRIQQEKRRRRQVTKMLFVLVVVFGICWAPFHTDRLMWSFISQWTGE 267
7tmA_NPFFR cd15207
neuropeptide FF receptors, member of the class A family of seven-transmembrane G ...
5-40 1.32e-05

neuropeptide FF receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320335 [Multi-domain]  Cd Length: 291  Bit Score: 39.91  E-value: 1.32e-05
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 385283635   5 ALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15207  208 AQAAVSKKKVRVIKMLIVVVVLFALSWLPLHTVTML 243
7tmA_NMU-R2 cd15357
neuromedin U receptor subtype 2, member of the class A family of seven-transmembrane G ...
13-40 2.53e-05

neuromedin U receptor subtype 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuromedin U (NMU) is a highly conserved neuropeptide with a common C-terminal heptapeptide sequence (FLFRPRN-amide) found at the highest levels in the gastrointestinal tract and pituitary gland of mammals. Disruption or replacement of residues in the conserved heptapeptide region can result in the reduced ability of NMU to stimulate smooth-muscle contraction. Two G-protein coupled receptor subtypes, NMU-R1 and NMU-R2, with a distinct expression pattern, have been identified to bind NMU. NMU-R1 is expressed primarily in the peripheral nervous system, while NMU-R2 is mainly found in the central nervous system. Neuromedin S, a 36 amino-acid neuropeptide that shares a conserved C-terminal heptapeptide sequence with NMU, is a highly potent and selective NMU-R2 agonist. Pharmacological studies have shown that both NMU and NMS inhibit food intake and reduce body weight, and that NMU increases energy expenditure.


Pssm-ID: 320479 [Multi-domain]  Cd Length: 293  Bit Score: 39.07  E-value: 2.53e-05
                         10        20
                 ....*....|....*....|....*...
gi 385283635  13 RREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15357  218 RKSVTKMLFVLVLVFAICWAPFHVDRLF 245
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
11-44 2.74e-05

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101 [Multi-domain]  Cd Length: 282  Bit Score: 38.81  E-value: 2.74e-05
                         10        20        30
                 ....*....|....*....|....*....|....
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRILKLTI 44
Cdd:cd14970  208 RARRKVTRLVLVVVAVFVVCWLPFHVFQIVRLLI 241
7tmA_OXR cd15208
orexin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
10-41 2.99e-05

orexin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Orexins (OXs, also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. Thus, activation of OX1R or OX2R will activate phospholipase activity and the phosphatidylinositol and calcium signaling pathways. Additionally, OX2R activation can also lead to inhibition of adenylate cyclase.


Pssm-ID: 320336 [Multi-domain]  Cd Length: 303  Bit Score: 38.91  E-value: 2.99e-05
                         10        20        30
                 ....*....|....*....|....*....|..
gi 385283635  10 LKQRREVAKTVFCLVLVFALCWLPLHLSRILK 41
Cdd:cd15208  226 LRSRRKTAKMLIVVVIMFAICYLPVHLLNILR 257
7tmA_Apelin_R cd15190
apelin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
6-53 3.00e-05

apelin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Apelin (APJ) receptor is a G protein-coupled receptor that binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake.


Pssm-ID: 341340 [Multi-domain]  Cd Length: 304  Bit Score: 38.97  E-value: 3.00e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*...
gi 385283635   6 LSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPNRC 53
Cdd:cd15190  218 RRKEDKKKRRLLKIIITLVVTFALCWLPFHLVKTLYALMYLGILPFSC 265
7tmA_NPR-like_invertebrate cd15391
invertebrate neuropeptide receptor-like, member of the class A family of seven-transmembrane G ...
9-40 3.02e-05

invertebrate neuropeptide receptor-like, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes putative neuropeptide receptor found in invertebrates, which is a member of class A of 7-transmembrane G protein-coupled receptors. This orphan receptor shares a significant amino acid sequence identity with the neurokinin 1 receptor (NK1R). The endogenous ligand for NK1R is substance P, an 11-amino acid peptide that functions as a vasodilator and neurotransmitter and is released from the autonomic sensory nerve fibers.


Pssm-ID: 320513 [Multi-domain]  Cd Length: 289  Bit Score: 39.04  E-value: 3.02e-05
                         10        20        30
                 ....*....|....*....|....*....|..
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15391  210 QIKSKRKVIKMLVFVVLMFGICWLPLHLFNLV 241
7tmA_TACR cd15390
neurokinin receptors (or tachykinin receptors), member of the class A family of ...
8-40 3.25e-05

neurokinin receptors (or tachykinin receptors), member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320512 [Multi-domain]  Cd Length: 289  Bit Score: 38.81  E-value: 3.25e-05
                         10        20        30
                 ....*....|....*....|....*....|...
gi 385283635   8 DHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15390  211 ESVRAKRKVVKMMIVVVVIFAICWLPYHLYFIL 243
7tmA_BRS-3 cd15123
bombesin receptor subtype 3, member of the class A family of seven-transmembrane G ...
9-36 3.79e-05

bombesin receptor subtype 3, member of the class A family of seven-transmembrane G protein-coupled receptors; BRS-3 is classified as an orphan receptor and belongs to the bombesin subfamily of G-protein coupled receptors, whose members also include neuromedin B receptor (NMBR) and gastrin-releasing peptide receptor (GRPR). Bombesin is a tetradecapeptide, originally isolated from frog skin. Mammalian bombesin-related peptides are widely distributed in the gastrointestinal and central nervous systems. The bombesin family receptors couple primarily to the G proteins of G(q/11) family. BRS-3 interacts with known naturally-occurring bombesin-related peptides with low affinity; however, no endogenous high-affinity ligand to the receptor has been identified. BRS-3 is suggested to play a role in sperm cell division and maturation.


Pssm-ID: 320251 [Multi-domain]  Cd Length: 294  Bit Score: 38.75  E-value: 3.79e-05
                         10        20
                 ....*....|....*....|....*...
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHL 36
Cdd:cd15123  215 QIESRKRVAKTVLVLVALFAFCWLPNHI 242
7tmA_NKR_NK3R cd16003
neuromedin-K receptor, member of the class A family of seven-transmembrane G protein-coupled ...
8-40 3.91e-05

neuromedin-K receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The neuromedin-K receptor (NKR), also known as tachykinin receptor 3 (TACR3) or neurokinin B receptor or NK3R, is a G-protein coupled receptor that specifically binds to neurokinin B. The tachykinins (TKs) act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320669 [Multi-domain]  Cd Length: 282  Bit Score: 38.76  E-value: 3.91e-05
                         10        20        30
                 ....*....|....*....|....*....|...
gi 385283635   8 DHLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd16003  204 EQLRAKRKVVKMMIIVVLTFAICWLPYHIYFIV 236
7tmA_NTSR-like cd14979
neurotensin receptors and related G protein-coupled receptors, member of the class A family of ...
5-51 4.77e-05

neurotensin receptors and related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes the neurotensin receptors and related G-protein coupled receptors, including neuromedin U receptors, growth hormone secretagogue receptor, motilin receptor, the putative GPR39 and the capa receptors from insects. These receptors all bind peptide hormones with diverse physiological effects. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320110 [Multi-domain]  Cd Length: 300  Bit Score: 38.49  E-value: 4.77e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 385283635   5 ALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPN 51
Cdd:cd14979  217 ELSLSQQARRQVVKMLGAVVIAFFVCWLPFHAQRLMFSYASKEDTFL 263
7tmA_GRPR cd15124
gastrin-releasing peptide receptor, member of the class A family of seven-transmembrane G ...
9-49 5.11e-05

gastrin-releasing peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The gastrin-releasing peptide receptor (GRPR) is a G-protein coupled receptor whose endogenous ligand is gastrin releasing peptide. GRP shares high sequence homology with the neuropeptide neuromedin B in the C-terminal region. This receptor is high glycosylated and couples to a pertussis-toxin-insensitive G protein of the family of Gq/11, which leads to the activation of phospholipase C. Gastrin-releasing peptide (GRP) is a potent mitogen for neoplastic tissues and involved in regulating multiple functions of the gastrointestinal and central nervous systems. These include the release of gastrointestinal hormones, the contraction of smooth muscle cells, and the proliferation of epithelial cells. GRPR belongs to the bombesin subfamily of G-protein coupled receptors, whose members also include neuromedin B receptor (NMBR) and bombesin receptor subtype 3 (BRS-3). Bombesin is a tetradecapeptide, originally isolated from frog skin.


Pssm-ID: 320252 [Multi-domain]  Cd Length: 293  Bit Score: 38.34  E-value: 5.11e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKD 49
Cdd:cd15124  215 QIESRKRLAKTVLVFVGLFAFCWLPNHIIYLYRSYHYSEVD 255
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
11-41 6.52e-05

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224 [Multi-domain]  Cd Length: 284  Bit Score: 38.05  E-value: 6.52e-05
                         10        20        30
                 ....*....|....*....|....*....|.
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRILK 41
Cdd:cd15096  210 RGKRRVTRLVVVVVVVFAICWLPIHIILLLK 240
7tmA_leucokinin-like cd15393
leucokinin-like peptide receptor from tick and related proteins, member of the class A family ...
10-44 7.50e-05

leucokinin-like peptide receptor from tick and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a leucokinin-like peptide receptor from the Southern cattle tick, Boophilus microplus, a pest of cattle world-wide. Leucokinins are invertebrate neuropeptides that exhibit myotropic and diuretic activity. This receptor is the first neuropeptide receptor known from the Acari and the second known in the subfamily of leucokinin-like peptide G-protein-coupled receptors. The other known leucokinin-like peptide receptor is a lymnokinin receptor from the mollusc Lymnaea stagnalis.


Pssm-ID: 320515 [Multi-domain]  Cd Length: 288  Bit Score: 37.77  E-value: 7.50e-05
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 385283635  10 LKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTI 44
Cdd:cd15393  212 LKNKKKVIKMLIIVVALFALCWLPLQTYNLLNEIK 246
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
7-44 7.70e-05

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216 [Multi-domain]  Cd Length: 278  Bit Score: 37.82  E-value: 7.70e-05
                         10        20        30
                 ....*....|....*....|....*....|....*...
gi 385283635   7 SDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTI 44
Cdd:cd15088  201 SHGSSRTKRVTKMVILIVVVFIVCWLPFHVVQLVNLAM 238
7tmA_TACR_family cd14992
tachykinin receptor and closely related proteins, member of the class A family of ...
9-40 1.26e-04

tachykinin receptor and closely related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family as well as closely related receptors. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320123 [Multi-domain]  Cd Length: 291  Bit Score: 37.03  E-value: 1.26e-04
                         10        20        30
                 ....*....|....*....|....*....|..
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd14992  214 RLKCKRRVIKMLVCVVVLFVICWLPFHLFFLL 245
7tmA_NPY2R cd15399
neuropeptide Y receptor type 2, member of the class A family of seven-transmembrane G ...
8-35 1.40e-04

neuropeptide Y receptor type 2, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320521 [Multi-domain]  Cd Length: 285  Bit Score: 37.11  E-value: 1.40e-04
                         10        20
                 ....*....|....*....|....*...
gi 385283635   8 DHLKQRREVAKTVFCLVLVFALCWLPLH 35
Cdd:cd15399  207 HYHQRRRKTTKMLVCVVVVFAVSWLPFH 234
7tmA_TACR-like cd15202
tachykinin receptors and related receptors, member of the class A family of ...
10-40 1.75e-04

tachykinin receptors and related receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the neurokinin/tachykinin receptors and its closely related receptors such as orphan GPR83 and leucokinin-like peptide receptor. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320330 [Multi-domain]  Cd Length: 288  Bit Score: 36.71  E-value: 1.75e-04
                         10        20        30
                 ....*....|....*....|....*....|.
gi 385283635  10 LKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15202  213 RRKKKKVIKMLMVVVVLFALCWLPFNIYVLL 243
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
11-51 4.97e-04

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 35.35  E-value: 4.97e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 385283635   11 KQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPN 51
Cdd:pfam00001 192 QRRRKALKTLAVVVVVFILCWLPYHIVNLLDSLALDCELSR 232
7tmA_SSTR5 cd15974
somatostatin receptor type 5, member of the class A family of seven-transmembrane G ...
1-50 5.64e-04

somatostatin receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR5 is coupled to inward rectifying K channels and phospholipase C, and plays critical roles in growth hormone and insulin secretion. SSTR5 acts as a negative regulator of PDX-1 (pancreatic and duodenal homeobox-1) expression, which is a conserved homeodomain-containing beta cell-specific transcription factor essentially involved in pancreatic development, among many other functions.


Pssm-ID: 320640 [Multi-domain]  Cd Length: 277  Bit Score: 35.16  E-value: 5.64e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
gi 385283635   1 GVQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDP 50
Cdd:cd15974  193 GLRVGSTKRRKSERKVTRMVVIIVVVFVFCWLPFYMLNIVNLIVILPEEP 242
7tmA_GHSR-like cd15928
growth hormone secretagogue receptor, motilin receptor, and related proteins, member of the ...
13-40 5.67e-04

growth hormone secretagogue receptor, motilin receptor, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes growth hormone secretagogue receptor (GHSR or ghrelin receptor), motilin receptor (also called GPR38), and related proteins. Both GHSR and GPR38 bind peptide hormones. Ghrelin, the endogenous ligand for GHSR, is an acylated 28-amino acid peptide hormone produced by ghrelin cells in the gastrointestinal tract. Ghrelin is also called the hunger hormone and is involved in the regulation of growth hormone release, appetite and feeding, gut motility, lipid and glucose metabolism, and energy balance. Motilin, the ligand for GPR38, is a 22 amino acid peptide hormone expressed throughout the gastrointestinal tract and stimulates contraction of gut smooth muscle. It is involved in the regulation of digestive tract motility.


Pssm-ID: 320594 [Multi-domain]  Cd Length: 288  Bit Score: 35.16  E-value: 5.67e-04
                         10        20
                 ....*....|....*....|....*...
gi 385283635  13 RREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15928  213 HRQTVRMLAVIVLAFVLCWLPFHVGRVI 240
7tmA_Histamine_H3R_H4R cd15048
histamine receptor subtypes H3R and H4R, member of the class A family of seven-transmembrane G ...
8-51 8.26e-04

histamine receptor subtypes H3R and H4R, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes histamine subtypes H3R and H4R, members of the histamine receptor family, which belong to the class A of GPCRs. Histamine plays a key role as chemical mediator and neurotransmitter in various physiological and pathophysiological processes in the central and peripheral nervous system. Histamine exerts its functions by binding to four different G protein-coupled receptors (H1-H4). The H3 and H4 receptors couple to the G(i)-proteins, which leading to the inhibition of cAMP formation. The H3R receptor functions as a presynaptic autoreceptors controlling histamine release and synthesis. The H4R plays an important role in histamine-mediated chemotaxis in mast cells and eosinophils. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320176 [Multi-domain]  Cd Length: 296  Bit Score: 34.97  E-value: 8.26e-04
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 385283635   8 DHLKQRREVAKTVFCLVLVFALCWLPLHLSRILkLTIYDEKDPN 51
Cdd:cd15048  221 VKLRRDRKAAKSLAILVLVFLICWAPYTILTII-RSFCSGSCVD 263
7tmA_NMBR cd15125
neuromedin B receptor, member of the class A family of seven-transmembrane G protein-coupled ...
7-51 8.35e-04

neuromedin B receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The neuromedin B receptor (NMBR), also known as BB1, is a G-protein coupled receptor whose endogenous ligand is the neuropeptide neuromedin B. Neuromedin B is a potent mitogen and growth factor for normal and cancerous lung and for gastrointestinal epithelial tissues. NMBR is widely distributed in the CNS, with especially high levels in olfactory nucleus and thalamic regions. The receptor couples primarily to a pertussis-toxin-insensitive G protein of the Gq/11 family, which leads to the activation of phospholipase C. NMBR belongs to the bombesin subfamily of G-protein coupled receptors, whose members also include gastrin-releasing peptide receptor (GRPR) and bombesin receptor subtype 3 (BRS-3). Bombesin is a tetradecapeptide, originally isolated from frog skin.


Pssm-ID: 320253 [Multi-domain]  Cd Length: 292  Bit Score: 34.93  E-value: 8.35e-04
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 385283635   7 SDHLKQ----RREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDPN 51
Cdd:cd15125  208 SEHSKRqmetRKRLAKIVLVFVGLFAFCWFPNHVLYMYRSFNYNEIDSS 256
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
13-36 8.57e-04

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226 [Multi-domain]  Cd Length: 282  Bit Score: 34.70  E-value: 8.57e-04
                         10        20
                 ....*....|....*....|....
gi 385283635  13 RREVAKTVFCLVLVFALCWLPLHL 36
Cdd:cd15098  210 KKKTAQTVLVVVVVFGISWLPHHI 233
7tmA_Adenosine_R cd14968
adenosine receptor subfamily, member of the class A family of seven-transmembrane G ...
10-36 1.10e-03

adenosine receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; The adenosine receptors (or P1 receptors), a family of G protein-coupled purinergic receptors, bind adenosine as their endogenous ligand. There are four types of adenosine receptors in human, designated as A1, A2A, A2B, and A3. Each type is encoded by a different gene and has distinct functions with some overlap. For example, both A1 and A2A receptors are involved in regulating myocardial oxygen consumption and coronary blood flow in the heart, while the A2A receptor also has a broad spectrum of anti-inflammatory effects in the body. These two receptors also expressed in the brain, where they have important roles in the release of other neurotransmitters such as dopamine and glutamate, while the A2B and A3 receptors found primarily in the periphery and play important roles in inflammation and immune responses. The A1 and A3 receptors preferentially interact with G proteins of the G(i/o) family, thereby lowering the intracellular cAMP levels, whereas the A2A and A2B receptors interact with G proteins of the G(s) family, activating adenylate cyclase to elevate cAMP levels.


Pssm-ID: 341316 [Multi-domain]  Cd Length: 285  Bit Score: 34.54  E-value: 1.10e-03
                         10        20
                 ....*....|....*....|....*..
gi 385283635  10 LKQRREVAKTVFCLVLVFALCWLPLHL 36
Cdd:cd14968  212 LQKEVKAAKSLAIILFLFALCWLPLHI 238
7tmA_PR4-like cd15392
neuropeptide Y receptor-like found in insect and related proteins, member of the class A ...
11-46 1.24e-03

neuropeptide Y receptor-like found in insect and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a novel G protein-coupled receptor (also known as PR4 receptor) from Drosophila melanogaster, which can be activated by the members of the neuropeptide Y (NPY) family, including NPY, peptide YY (PYY) and pancreatic polypeptide (PP), when expressed in Xenopus oocytes. These homologous peptides of 36-amino acids in length contain a hairpin-like structural motif, which referred to as the pancreatic polypeptide fold, and function as gastrointestinal hormones and neurotransmitters. The PR4 receptor also shares strong sequence homology to the mammalian tachykinin receptors (NK1R, NK2R, and NK3R), whose endogenous ligands are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB), respectively. The tachykinins function as excitatory transmitters on neurons and cells in the gastrointestinal tract.


Pssm-ID: 320514 [Multi-domain]  Cd Length: 287  Bit Score: 34.26  E-value: 1.24e-03
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYD 46
Cdd:cd15392  212 ESKRKLVKMMITVVAIFALCWLPLNILNLVGDHDES 247
7tmA_GPR83 cd15389
G protein-coupled receptor 83, member of the class A family of seven-transmembrane G ...
9-40 2.08e-03

G protein-coupled receptor 83, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR83, also known as GPR72, is widely expressed in the brain, including hypothalamic nuclei which is involved in regulating energy balance and food intake. The hypothalamic expression of GPR83 is tightly regulated in response to nutrient availability and is decreased in obese mice. A recent study suggests that GPR83 has a critical role in the regulation of systemic energy metabolism via ghrelin-dependent and ghrelin-independent mechanisms. GPR83 shares a significant amino acid sequence identity with the tachykinin receptors, however its endogenous ligand is unknown.


Pssm-ID: 320511 [Multi-domain]  Cd Length: 285  Bit Score: 33.85  E-value: 2.08e-03
                         10        20        30
                 ....*....|....*....|....*....|..
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15389  212 QRRKKKKTIKMLMLVVLLFAICWLPLNCYHVL 243
7tmA_Galanin_R-like cd14971
galanin receptor and related proteins, member of the class A family of seven-transmembrane G ...
13-36 2.16e-03

galanin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled galanin receptors, kisspeptin receptor and allatostatin-A receptor (AstA-R) in insects. These receptors, which are members of the class A of seven transmembrane GPCRs, share a high degree of sequence homology among themselves. The galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, eating disorders, and epilepsy, among many others. KiSS1-derived peptide receptor (also known as GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. AstA-R is a G-protein coupled receptor that binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320102 [Multi-domain]  Cd Length: 281  Bit Score: 33.59  E-value: 2.16e-03
                         10        20
                 ....*....|....*....|....
gi 385283635  13 RREVAKTVFCLVLVFALCWLPLHL 36
Cdd:cd14971  209 KRKVTRLVLVVVVLFAACWGPIHA 232
7tmA_motilin_R cd15132
motilin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
11-40 2.69e-03

motilin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Motilin receptor, also known as GPR38, is a G-protein coupled receptor that binds the endogenous ligand motilin. Motilin is a 22 amino acid peptide hormone expressed throughout the gastrointestinal tract and stimulates contraction of gut smooth muscle. Motilin is also called as the housekeeper of the gut because it is responsible for the proper filling and emptying of the gastrointestinal tract in response to food intake, and for stimulating the production of pepsin. Motilin receptor shares significant amino acid sequence identity with the growth hormone secretagogue receptor (GHSR) and neurotensin receptors (NTS-R1 and 2).


Pssm-ID: 320260 [Multi-domain]  Cd Length: 289  Bit Score: 33.23  E-value: 2.69e-03
                         10        20        30
                 ....*....|....*....|....*....|
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15132  214 RSHRQTVRILAVVVLAFIICWLPFHIGRIL 243
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
10-40 2.72e-03

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331 [Multi-domain]  Cd Length: 293  Bit Score: 33.35  E-value: 2.72e-03
                         10        20        30
                 ....*....|....*....|....*....|.
gi 385283635  10 LKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15203  216 LRRKRRTNRLLIAMVVVFAVCWLPLNLFNLL 246
7tmA_Adenosine_R_A2B cd15069
adenosine receptor subtype 2AB, member of the class A family of seven-transmembrane G ...
3-35 2.90e-03

adenosine receptor subtype 2AB, member of the class A family of seven-transmembrane G protein-coupled receptors; The A2B receptor, a member of the adenosine receptor family of G protein-coupled receptors, binds adenosine as its endogenous ligand and is involved in regulating myocardial oxygen consumption and coronary blood flow. High-affinity A2A and low-affinity A2B receptors are preferentially coupled to G proteins of the stimulatory (Gs) family, which lead to activation of adenylate cyclase and thereby increasing the intracellular cAMP levels. The A2A receptor activation protects against tissue injury and acts as anti-inflammatory agent. In human skin endothelial cells, activation of A2B receptor, but not the A2A receptor, promotes angiogenesis. Alternatively, activated A2A receptor, but not the A2B receptor, promotes angiogenesis in human umbilical vein and lung microvascular endothelial cells. The A2A receptor alters cardiac contractility indirectly by modulating the anti-adrenergic effect of A1 receptor, while the A2B receptor exerts direct effects on cardiac contractile function, but does not modulate beta-adrenergic or A1 anti-adrenergic effects.


Pssm-ID: 320197 [Multi-domain]  Cd Length: 294  Bit Score: 33.37  E-value: 2.90e-03
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 385283635   3 QIALSDH----LKQRREVAKTVFCLVLVFALCWLPLH 35
Cdd:cd15069  208 RTELMDHsrttLQREIHAAKSLAIIVGIFALCWLPVH 244
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
6-37 2.92e-03

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341333 [Multi-domain]  Cd Length: 279  Bit Score: 33.40  E-value: 2.92e-03
                         10        20        30
                 ....*....|....*....|....*....|..
gi 385283635   6 LSDHLKQRREVAKTVFCLVLVFALCWLPLHLS 37
Cdd:cd15178  193 LQTRSFQKHRAMRVIFAVVLAFLLCWLPYNVT 224
7tmA_NK1R cd16002
neurokinin 1 receptor, member of the class A family of seven-transmembrane G protein-coupled ...
8-36 3.13e-03

neurokinin 1 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The neurokinin 1 receptor (NK1R), also known as tachykinin receptor 1 (TACR1) or substance P receptor (SPR), is a G-protein coupled receptor found in the mammalian central nervous and peripheral nervous systems. The tachykinins act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. SP is an extremely potent vasodilator through endothelium dependent mechanism and is released from the autonomic sensory nerves. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception.


Pssm-ID: 320668 [Multi-domain]  Cd Length: 284  Bit Score: 33.30  E-value: 3.13e-03
                         10        20
                 ....*....|....*....|....*....
gi 385283635   8 DHLKQRREVAKTVFCLVLVFALCWLPLHL 36
Cdd:cd16002  206 EQVSAKRKVVKMMIVVVCTFAICWLPYHI 234
7tmA_GHSR cd15131
growth hormone secretagogue receptor, member of the class A family of seven-transmembrane G ...
11-40 3.48e-03

growth hormone secretagogue receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Growth hormone secretagogue receptor, GHSR, is also known as GH-releasing peptide receptor (GHRP) or Ghrelin receptor. Ghrelin, the endogenous ligand for GHSR, is an acylated 28-amino acid peptide hormone produced by ghrelin cells in the gastrointestinal tract. Ghrelin, also called hunger hormone, is involved in the regulation of growth hormone release, appetite and feeding, gut motility, lipid and glucose metabolism, and energy balance. It also plays a role in the cardiovascular, immune, and reproductive systems. GHSR couples to G-alpha-11 proteins. Both ghrelin and GHSR are expressed in a wide range of cancer tissues. Recent studies suggested that ghrelin may play a role in processes associated with cancer progression, including cell proliferation, metastasis, apoptosis, and angiogenesis.


Pssm-ID: 320259 [Multi-domain]  Cd Length: 291  Bit Score: 32.93  E-value: 3.48e-03
                         10        20        30
                 ....*....|....*....|....*....|
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd15131  213 KNNRQTVKMLAVVVFAFVLCWLPFHVGRYL 242
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
11-40 5.12e-03

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 32.44  E-value: 5.12e-03
                         10        20        30
                 ....*....|....*....|....*....|
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:PHA03087 237 KKNKKAIKLVLIIVILFVIFWLPFNVSVFV 266
7tmA_LTB4R cd14975
leukotriene B4 receptors, member of the class A family of seven-transmembrane G ...
10-44 5.29e-03

leukotriene B4 receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Leukotriene B4 (LTB4), a metabolite of arachidonic acid, is a powerful chemotactic activator for granulocytes and macrophages. Two receptors for LTB4 have been identified: a high-affinity receptor (LTB4R1 or BLT1) and a low-affinity receptor (TB4R2 or BLT2). Both BLT1 and BLT2 receptors belong to the rhodopsin-like G-protein coupled receptor superfamily and primarily couple to G(i) proteins, which lead to chemotaxis, calcium mobilization, and inhibition of adenylate cyclase. In some cells, they can also couple to the G(q)-like protein, G16, and activate phospholipase C. LTB4 is involved in mediating inflammatory processes, immune responses, and host defense against infection. Studies have shown that LTB4 stimulates leukocyte extravasation, neutrophil degranulation, lysozyme release, and reactive oxygen species generation.


Pssm-ID: 320106 [Multi-domain]  Cd Length: 278  Bit Score: 32.45  E-value: 5.29e-03
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 385283635  10 LKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTI 44
Cdd:cd14975  194 FRRRRRTGRLIASVVVAFAACWLPYHVGNLLEVVS 228
7tmA_SSTR3 cd15972
somatostatin receptor type 3, member of the class A family of seven-transmembrane G ...
2-50 5.68e-03

somatostatin receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR3 is coupled to inward rectifying potassium channels. SSTR3 plays critical roles in growth hormone secretion, endothelial cell cycle arrest and apoptosis. Furthermore, SSTR3 is expressed in the normal human pituitary and in nearly half of pituitary growth hormone adenomas.


Pssm-ID: 320638 [Multi-domain]  Cd Length: 279  Bit Score: 32.47  E-value: 5.68e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
gi 385283635   2 VQIALSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDP 50
Cdd:cd15972  196 VRATSTKRRGSERKVTRMVVIVVAAFVLCWLPFYALNIVNLVCPLPEEP 244
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
11-50 5.70e-03

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221 [Multi-domain]  Cd Length: 280  Bit Score: 32.43  E-value: 5.70e-03
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRILKLTIYDEKDP 50
Cdd:cd15093  206 RSERKVTRMVVMVVVVFVICWLPFYVLQLVNVFVQLPETP 245
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
12-42 6.69e-03

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 341329 [Multi-domain]  Cd Length: 284  Bit Score: 32.29  E-value: 6.69e-03
                         10        20        30
                 ....*....|....*....|....*....|.
gi 385283635  12 QRREVAKTVFCLVLVFALCWLPLHLSRILKL 42
Cdd:cd15168  204 LRRKSIRLVIIVLALFAVCFLPFHVTRTINL 234
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
9-40 7.00e-03

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 341320 [Multi-domain]  Cd Length: 284  Bit Score: 32.35  E-value: 7.00e-03
                         10        20        30
                 ....*....|....*....|....*....|..
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRIL 40
Cdd:cd14985  202 NGRKRRKSLKIIFALVVAFLVCWLPFHFFKFL 233
7tmA_RXFP1_LGR7 cd15965
relaxin receptor 1 (or LGR7), member of the class A family of seven-transmembrane G ...
6-42 7.08e-03

relaxin receptor 1 (or LGR7), member of the class A family of seven-transmembrane G protein-coupled receptors; Relaxin is a member of the insulin superfamily that has diverse actions in both reproductive and non-reproductive tissues. The relaxin-like peptide family includes relaxin-1, relaxin-2, and the insulin-like (INSL) peptides such as INSL3, INSL4, INSL5 and INSL6. The relaxin family peptides share high structural but low sequence similarity, and exert their physiological functions by activating a group of four G protein-coupled receptors, RXFP1-4. Relaxin is the endogenous ligand for RXFP1, which has a large extracellular N-terminal domain containing 10 leucine-rich repeats and a unique low-density lipoprotein type A (LDLa) module which is necessary for receptor activation. Upon receptor binding, relaxin activates a variety of signaling pathways to produce second messengers such as cAMP and nitric oxide. RXFP1 is expressed in various tissues including uterus, ovary, placenta, cerebral cortex, heart, lung and kidney, among others.


Pssm-ID: 320631 [Multi-domain]  Cd Length: 287  Bit Score: 32.15  E-value: 7.08e-03
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 385283635   6 LSDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKL 42
Cdd:cd15965  211 ISNHIKKEMTLAKRFFFIVFTDALCWIPIFILKLLSL 247
7tmA_GPR1 cd15119
G protein-coupled receptor 1 for chemerin, member of the class A family of seven-transmembrane ...
19-45 8.96e-03

G protein-coupled receptor 1 for chemerin, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor 1 (GPR1) belongs to the class A of the seven transmembrane domain receptors. This is an orphan receptor that can be activated by the leukocyte chemoattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1. GPR1 is most closely related to another chemerin receptor CMKLR1. In an in-vitro study, GPR1 has been shown to act as a co-receptor to allow replication of HIV viruses.


Pssm-ID: 320247 [Multi-domain]  Cd Length: 278  Bit Score: 32.02  E-value: 8.96e-03
                         10        20
                 ....*....|....*....|....*..
gi 385283635  19 TVFCLVLVFALCWLPLHLSRILKLTIY 45
Cdd:cd15119  210 TISAVIVAFFVCWTPYHIFSILELSIH 236
7tmA_NPBWR cd15087
neuropeptide B/W receptors, member of the class A family of seven-transmembrane G ...
11-43 9.54e-03

neuropeptide B/W receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide B/W receptor 1 and 2 are members of the class A G-protein coupled receptors that bind the neuropeptides B and W, respectively. NPBWR1 (previously known as GPR7) is expressed predominantly in cerebellum and frontal cortex, while NPBWR2 (previously known as GPR8) is located mostly in the frontal cortex and is present in human, but not in rat and mice. These receptors are suggested to be involved in the regulation of food intake, neuroendocrine function, and modulation of inflammatory pain, among many others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320215 [Multi-domain]  Cd Length: 282  Bit Score: 32.02  E-value: 9.54e-03
                         10        20        30
                 ....*....|....*....|....*....|...
gi 385283635  11 KQRREVAKTVFCLVLVFALCWLPLHLSRILKLT 43
Cdd:cd15087  208 KAKKKVTLMVLVVLAVCLFCWTPFHLSTVVALT 240
7tmA_Adenosine_R_A2A cd15068
adenosine receptor subtype A2A, member of the class A family of seven-transmembrane G ...
10-36 9.66e-03

adenosine receptor subtype A2A, member of the class A family of seven-transmembrane G protein-coupled receptors; The A2A receptor, a member of the adenosine receptor family of G protein-coupled receptors, binds adenosine as its endogenous ligand and is involved in regulating myocardial oxygen consumption and coronary blood flow. High-affinity A2A and low-affinity A2B receptors are preferentially coupled to G proteins of the stimulatory (Gs) family, which lead to activation of adenylate cyclase and thereby increasing the intracellular cAMP levels. The A2A receptor activation protects against tissue injury and acts as anti-inflammatory agent. In human skin endothelial cells, activation of A2B receptor, but not the A2A receptor, promotes angiogenesis. Alternatively, activated A2A receptor, but not the A2B receptor, promotes angiogenesis in human umbilical vein and lung microvascular endothelial cells. The A2A receptor alters cardiac contractility indirectly by modulating the anti-adrenergic effect of A1 receptor, while the A2B receptor exerts direct effects on cardiac contractile function, but does not modulate beta-adrenergic or A1 anti-adrenergic effects.


Pssm-ID: 320196 [Multi-domain]  Cd Length: 293  Bit Score: 31.83  E-value: 9.66e-03
                         10        20
                 ....*....|....*....|....*..
gi 385283635  10 LKQRREVAKTVFCLVLVFALCWLPLHL 36
Cdd:cd15068  219 LQKEVHAAKSLAIIVGLFALCWLPLHI 245
7tmA_capaR cd15134
neuropeptide capa receptor and similar invertebrate proteins, member of the class A family of ...
9-45 9.86e-03

neuropeptide capa receptor and similar invertebrate proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; CapaR is a G-protein coupled receptor for the Drosophila melanogaster capa neuropeptides (Drm-capa-1 and -2), which act on the Malpighian tubules to increase fluid transport. The capa peptides are evolutionarily related to vertebrate Neuromedin U neuropeptide and contain a C-terminal FPRXamide motif. CapaR regulates fluid homeostasis through its ligands, thereby acts as a desiccation stress-responsive receptor. CapaR undergoes desensitization, with internalization mediated by beta-arrestin-2.


Pssm-ID: 320262 [Multi-domain]  Cd Length: 298  Bit Score: 31.92  E-value: 9.86e-03
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 385283635   9 HLKQRREVAKTVFCLVLVFALCWLPLHLSRIlkLTIY 45
Cdd:cd15134  219 SSQSRRTVLRMLVAVVVAFFICWAPFHAQRL--LTVY 253
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH