NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|156958840|gb|ABU98380|]
View 

wingless, partial [Gnathocerus cornutus]

Protein Classification

wnt family protein( domain architecture ID 1562737)

wnt family protein may function in development and differentiation

Gene Ontology:  GO:0016055|GO:0005102|GO:0005576
PubMed:  22952392|20477987|8167409
SCOP:  4005649|4007801

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Wnt super family cl38924
Wnt domain found in the WNT signaling gene family, also called Wingless-type mouse mammary ...
 1-134 1.18e-56

Wnt domain found in the WNT signaling gene family, also called Wingless-type mouse mammary tumor virus (MMTV) integration site family; Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about the structure of Wnt proteins, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. Wnt signaling mediated by Wnt proteins orchestrates and influences a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


The actual alignment was detected with superfamily member cd19333:

Pssm-ID: 393294  Cd Length: 311  Bit Score: 178.32  E-value: 1.18e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHHRNSNNAhrnrppknpklnningnsihskrenkrkhkYGFQLKPFNP 80
Cdd:cd19333  171 TCWMRLPTFRTVGDRLKDRFDGASRVAYGNNGNNRGSRRA------------------------------KKFLLEPENP 220

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19333  221 NHKPPTSKDLVYFEESPNFCEKNPKLGTLGTRGRECNATSIGLDGCDLMCCGRG 274
 
Name Accession Description Interval E-value
Wnt_Wnt1 cd19333
Wnt domain found in proto-oncogene Wnt-1 and similar proteins; Wnt-1, also called ...
 1-134 1.18e-56

Wnt domain found in proto-oncogene Wnt-1 and similar proteins; Wnt-1, also called proto-oncogene Int-1, acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. It plays a role in osteoblast function, bone development and bone homeostasis. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381707  Cd Length: 311  Bit Score: 178.32  E-value: 1.18e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHHRNSNNAhrnrppknpklnningnsihskrenkrkhkYGFQLKPFNP 80
Cdd:cd19333  171 TCWMRLPTFRTVGDRLKDRFDGASRVAYGNNGNNRGSRRA------------------------------KKFLLEPENP 220

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19333  221 NHKPPTSKDLVYFEESPNFCEKNPKLGTLGTRGRECNATSIGLDGCDLMCCGRG 274
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
 1-134 1.54e-45

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 459677  Cd Length: 307  Bit Score: 149.62  E-value: 1.54e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840    1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNsghhrnsnnahrnrppknpklnningnsihskreNKRKhkygfQLKPFNP 80
Cdd:pfam00110 176 TCWKALPPFREVGDRLKEKYDGAVKVNRRR----------------------------------NKRG-----RLVPRNS 216

                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 156958840   81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:pfam00110 217 RFKPPTKNDLVYLEKSPDYCERNPKTGSLGTRGRECNKTSSGPDGCDLLCCGRG 270
WNT1 smart00097
found in Wnt-1;
1-134 3.16e-39

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 133.60  E-value: 3.16e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840     1 TCWMRLPPFRVIGDLLKDRFDGASHVaasnsghhrnsnnahrnrppknpKLNNINGNSihskrenkrkhkygfQLKPFNP 80
Cdd:smart00097 173 TCWLQLPDFRKVGDYLKEKYDGASEV-----------------------EVDKRGTNK---------------APVPKNS 214

                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....
gi 156958840    81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:smart00097 215 TFKPPTETDLVYLESSPDFCEKNPKTGSLGTQGRQCNKTSKGLDGCDLLCCGRG 268
 
Name Accession Description Interval E-value
Wnt_Wnt1 cd19333
Wnt domain found in proto-oncogene Wnt-1 and similar proteins; Wnt-1, also called ...
 1-134 1.18e-56

Wnt domain found in proto-oncogene Wnt-1 and similar proteins; Wnt-1, also called proto-oncogene Int-1, acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. It plays a role in osteoblast function, bone development and bone homeostasis. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381707  Cd Length: 311  Bit Score: 178.32  E-value: 1.18e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHHRNSNNAhrnrppknpklnningnsihskrenkrkhkYGFQLKPFNP 80
Cdd:cd19333  171 TCWMRLPTFRTVGDRLKDRFDGASRVAYGNNGNNRGSRRA------------------------------KKFLLEPENP 220

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19333  221 NHKPPTSKDLVYFEESPNFCEKNPKLGTLGTRGRECNATSIGLDGCDLMCCGRG 274
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
 1-134 1.54e-45

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 459677  Cd Length: 307  Bit Score: 149.62  E-value: 1.54e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840    1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNsghhrnsnnahrnrppknpklnningnsihskreNKRKhkygfQLKPFNP 80
Cdd:pfam00110 176 TCWKALPPFREVGDRLKEKYDGAVKVNRRR----------------------------------NKRG-----RLVPRNS 216

                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 156958840   81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:pfam00110 217 RFKPPTKNDLVYLEKSPDYCERNPKTGSLGTRGRECNKTSSGPDGCDLLCCGRG 270
Wnt_Wnt6 cd19338
Wnt domain found in protein Wnt-6 and similar proteins; Wnt-6 may function as a signaling ...
 1-134 4.98e-42

Wnt domain found in protein Wnt-6 and similar proteins; Wnt-6 may function as a signaling molecule which affects the development of discrete regions of tissues. It may promote tumorigenesis in gastrointestinal cancer and cervical cancer. It can compensate for the absence of ectoderm and can induce the formation of muscle cells in the limb. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381712  Cd Length: 310  Bit Score: 140.82  E-value: 4.98e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHhrnsnnahrnrppknpklnningnsihskrenkrkhkygfQLKPFNP 80
Cdd:cd19338  180 TCWRKMPPFREVGDRLKERFDGAIKVKGSNDGK----------------------------------------SLIPEGK 219

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19338  220 TIKPPTKEDLVYLEESPDFCEPNKKTGSLGTRGRECNRTSMGVDGCDLLCCGRG 273
WNT1 smart00097
found in Wnt-1;
1-134 3.16e-39

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 133.60  E-value: 3.16e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840     1 TCWMRLPPFRVIGDLLKDRFDGASHVaasnsghhrnsnnahrnrppknpKLNNINGNSihskrenkrkhkygfQLKPFNP 80
Cdd:smart00097 173 TCWLQLPDFRKVGDYLKEKYDGASEV-----------------------EVDKRGTNK---------------APVPKNS 214

                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....
gi 156958840    81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:smart00097 215 TFKPPTETDLVYLESSPDFCEKNPKTGSLGTQGRQCNKTSKGLDGCDLLCCGRG 268
Wnt_Wnt4 cd19336
Wnt domain found in protein Wnt-4 and similar proteins; Wnt-4 may function as a signaling ...
 1-134 2.55e-34

Wnt domain found in protein Wnt-4 and similar proteins; Wnt-4 may function as a signaling molecule which affects the development of discrete regions of tissues. Its overexpression may be associated with abnormal proliferation in human breast tissue. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381710  Cd Length: 310  Bit Score: 120.88  E-value: 2.55e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAasnsghhrnsnnahrnrppknpklnningnsihSKRENKRKhkygfQLKPFNP 80
Cdd:cd19336  178 TCWRAMPTFREVGNILKEKFDGATEVQ---------------------------------QKRIGSRP-----VLVPKNP 219

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19336  220 QFKPHTDADLVYLDSSPDFCEPDPKTGSLGTHGRVCNKTSKAIDGCDLLCCGRG 273
Wnt_Wnt3_Wnt3a cd19335
Wnt domain found in proto-oncogene Wnt-3 and similar proteins; Wnt-3, also called ...
 1-134 6.49e-34

Wnt domain found in proto-oncogene Wnt-3 and similar proteins; Wnt-3, also called proto-oncogene Int-4, functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family. It is required for normal embryonic development, and especially for limb development. Wnt-3a functions in the canonical Wnt signaling pathway and plays crucial roles in both proliferation and differentiation processes in several types of stem cells. Wnt3a stimulates the migration and invasion of trophoblasts and induce the survival, proliferation, and migration of human embryonic kidney (HEK) 293 cells. It also up-regulates genes implicated in melanocyte differentiation and increases the expression and nuclear localization of the transcriptional co-activator with PDZ-binding motif (TAZ), a transcriptional modulator involved in activating osteoblastic differentiation. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381709  Cd Length: 314  Bit Score: 119.80  E-value: 6.49e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAasnsghhrnsnnahrnrppknpklnningnsIHSKRENKRKHKygfQLKPFNP 80
Cdd:cd19335  178 TCWWAQPDFRKIGDYLKDKYDSASEMV-------------------------------VERHRESRGWVE---TLRPKYK 223

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19335  224 LFKPPTERDLIYYEESPNFCEPNPETGSFGTRGRECNVTSHGIDGCDLLCCGRG 277
Wnt cd13113
Wnt domain found in the WNT signaling gene family, also called Wingless-type mouse mammary ...
 1-134 1.62e-32

Wnt domain found in the WNT signaling gene family, also called Wingless-type mouse mammary tumor virus (MMTV) integration site family; Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about the structure of Wnt proteins, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. Wnt signaling mediated by Wnt proteins orchestrates and influences a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381706  Cd Length: 288  Bit Score: 115.85  E-value: 1.62e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVaasnsghhrnsnnahrnrppknpKLNNingnsihskrenkrkHKYGFQLKPFNP 80
Cdd:cd13113  157 TCWRQLPSFREIGDYLKEKYDNAVKV-----------------------KLNN---------------NGSGLRLVPKRS 198

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd13113  199 RFRSPTETDLVYLEESPDYCEPNPTLGSLGTAGRECNPTSPGPDSCELLCCGRG 252
Wnt_Wnt2_like cd19334
Wnt domain found in protein Wnt-2, Wnt-2b and similar proteins; The family includes Wnt-2 and ...
 1-134 5.42e-32

Wnt domain found in protein Wnt-2, Wnt-2b and similar proteins; The family includes Wnt-2 and Wnt-2b. Wnt-2, also called Int-1-like protein 1 (INT1L1), or Int-1-related protein (IRP), functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family. It plays an important role in embryonic lung development. Wnt-2b, also called protein Wnt-13, functions in the canonical Wnt/beta-catenin signaling pathway. It plays a redundant role in embryonic lung development. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381708  Cd Length: 314  Bit Score: 114.74  E-value: 5.42e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHHRNSNNAHRNRPPKNpklnningnsihskrenkrkhkygfqlkpfnp 80
Cdd:cd19334  184 TCWRALAEFREVGDYLREKYDGAVQVTMNQSGTNLLAANKGHKKPTRS-------------------------------- 231

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehkppgvkDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19334  232 --------DLVYFESSPDYCVPNPETGSLGTAGRVCNKTSTGTDGCDIMCCGRG 277
Wnt_Wnt10 cd19342
Wnt domain found in protein Wnt-10a, Wnt-10b and similar proteins; The family includes protein ...
 1-134 1.44e-31

Wnt domain found in protein Wnt-10a, Wnt-10b and similar proteins; The family includes protein Wnt-10a and Wnt-10b. Wnt-10a plays a role in normal ectoderm development. It is required for normal postnatal development and maintenance of tongue papillae and sweat ducts, as well as normal hair follicle function. Wnt-10b, also called protein Wnt-12, specifically activates canonical Wnt/beta-catenin signaling and thus triggers beta-catenin/LEF/TCF-mediated transcriptional programs. It is involved in signaling networks controlling stemness, pluripotency, and cell fate decisions. Wnt-10b is unique and plays an important role in differentiation of epithelial cells in the hair follicle. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381716  Cd Length: 316  Bit Score: 113.90  E-value: 1.44e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHHRNSNNAHRNRPpknpklnningnsihskrenkrkhkygfqlkpfnp 80
Cdd:cd19342  182 TCWKAAPDFREVGDILKEKYDHATLVDQSNLNNGARRRRLTRRKR----------------------------------- 226

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 eHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19342  227 -RRRPPKTDLVYYERSPNFCEADPSLDSPGTRGRVCNKTSTGPDSCDSLCCGRG 279
Wnt_Wnt7 cd19339
Wnt domain found in protein Wnt-7a, Wnt-7b and similar proteins; The family includes Wnt-7a ...
 1-134 6.59e-30

Wnt domain found in protein Wnt-7a, Wnt-7b and similar proteins; The family includes Wnt-7a and Wnt-7b. Wnt-7a acts as a canonical Wnt ligand that modulates the synaptic vesicle cycle and synaptic transmission in hippocampal neurons. It also plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development, and urogenital tract development. Wnt-7b functions in the canonical Wnt/beta-catenin signaling pathway in vascular smooth muscle cells. It is required for normal fusion of the chorion and the allantois during placenta development. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381713  Cd Length: 313  Bit Score: 109.30  E-value: 6.59e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVaasnsghhrnsnNAHRNRPPKNPKLnningnsihSKRENKRKHKygfqlkpfnp 80
Cdd:cd19339  177 TCWTTLPSFREIGDYLKKKYERARRV------------EPVRGRRRRRPTF---------LKLKISRKYK---------- 225

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehKPPgVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19339  226 --KPR-PRDLVYLEKSPNYCEKDPLTGSLGTVGRRCNRTSTGTDGCDLMCCGRG 276
Wnt_Wnt5 cd19337
Wnt domain found in protein Wnt-5a, Wnt-5b and similar proteins; The family includes Wnt-5a ...
 1-134 2.02e-29

Wnt domain found in protein Wnt-5a, Wnt-5b and similar proteins; The family includes Wnt-5a and Wnt-5b, both of which are secreted growth factors that belong to the noncanonical members of the Wingless-related MMTV-integration family. Wnt-5a can activate or inhibit canonical Wnt signaling, depending on receptor context. It specifically regulates dendritic spine formation in rodent hippocampal neurons, resulting in postsynaptic development that promotes the clustering of the postsynaptic density protein 95 (PSD-95). The overexpression of Wnt-5b is associated with cancer aggressiveness. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381711  Cd Length: 313  Bit Score: 108.10  E-value: 2.02e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVaasnsghhrnsnnahrnrppknpklnningnsihskRENKRkhkyGFQLKPFNP 80
Cdd:cd19337  183 TCWRQLAPFREVGDRLKDKYDGAVKV------------------------------------KLNRR----GTLLRRRNS 222

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19337  223 RFNKPTKDDLVYLDDSPDYCERNPKTGSLGTKGRECNKTSSGTDGCELLCCGRG 276
Wnt_Wnt11 cd19343
Wnt domain found in protein Wnt-11 and similar proteins; Wnt-11 may be a signaling molecule ...
 1-134 2.59e-27

Wnt domain found in protein Wnt-11 and similar proteins; Wnt-11 may be a signaling molecule which has possible roles in the development of skeleton, kidney and lung. It is a positive regulator of the Wnt signaling pathway, which plays a crucial role in carcinogenesis. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381717  Cd Length: 305  Bit Score: 102.34  E-value: 2.59e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVaasnsghhrnsnnahrnrppknpklnningnsiHSKRENKRKHkygfqLKPFNP 80
Cdd:cd19343  173 TCWKALPDLSEVASRLKRKYARAVEV---------------------------------VSRKVGSRRK-----LVPKSL 214

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19343  215 KVRPYTKDDLIYLTKSPDYCLPDEKLGSLGTRGRECNKTSVGSDSCDSMCCGRG 268
Wnt_Wnt16 cd19344
Wnt domain found in protein Wnt-16 and similar proteins; Wnt-16 is a mixed canonical and ...
 1-134 6.27e-27

Wnt domain found in protein Wnt-16 and similar proteins; Wnt-16 is a mixed canonical and noncanonical Wnt ligand involved in the regulation of postnatal bone homeostasis. It promotes bone formation and inhibits bone resorption. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381718  Cd Length: 306  Bit Score: 101.54  E-value: 6.27e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASnsghhrnsnnahrnrppknpklnningnsiHSKRENKRKHKYGFQLkpfnp 80
Cdd:cd19344  174 TCWKTMPSFEEVGDFLKQKYENSIQIATK------------------------------KSKRRLRRRERRKRKV----- 218

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehkPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19344  219 ---PISKDELVYIHKSPNYCVRDPKKGILGTSGRECNRTSTGPDSCDLLCCGRG 269
Wnt_Wnt10a cd19355
Wnt domain found in protein Wnt-10a and similar proteins; Wnt-10a plays a role in normal ...
 1-134 1.30e-23

Wnt domain found in protein Wnt-10a and similar proteins; Wnt-10a plays a role in normal ectoderm development. It is required for normal postnatal development and maintenance of tongue papillae and sweat ducts, as well as normal hair follicle function. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381729  Cd Length: 302  Bit Score: 92.74  E-value: 1.30e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAAsnsgHHRNSNNAHRNRPPknpklnningnsiHSKRENkrkhkygfqlkpfnp 80
Cdd:cd19355  170 TCWQVTPEFRTVGSLLKDRFYVATLIKP----HNRNTGQLEPGHAP-------------HRRRAS--------------- 217

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehkppgVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19355  218 ------INDLVYFEKSPDFCEREPRLDSAGTQGRICNKTSPGMDNCESLCCGRG 265
Wnt_Wnt7a cd19349
Wnt domain found in protein Wnt-7a and similar proteins; Wnt-7a acts as a canonical Wnt ligand ...
 1-134 4.10e-23

Wnt domain found in protein Wnt-7a and similar proteins; Wnt-7a acts as a canonical Wnt ligand that modulates the synaptic vesicle cycle and synaptic transmission in hippocampal neurons. It also plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development and urogenital tract development. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381723  Cd Length: 318  Bit Score: 91.65  E-value: 4.10e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNsghhrnsnnAHRNRPPKNPKLNningnsihskrenkrkhkygfqlKPFNp 80
Cdd:cd19349  182 TCWTTLPKFRELGYILKDKYNEAVHVEPVR---------ASRNKRPTFLKIK-----------------------KPLS- 228

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 eHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19349  229 -YRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRMCNKTAQQNNGCDLMCCGRG 281
Wnt_Wnt5b cd19348
Wnt domain found in protein Wnt-5b and similar proteins; Wnt-5b is a secreted growth factor ...
 1-134 1.23e-22

Wnt domain found in protein Wnt-5b and similar proteins; Wnt-5b is a secreted growth factor that belongs to the noncanonical members of the Wingless-related MMTV-integration family. Its overexpression is associated with cancer aggressiveness. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381722  Cd Length: 312  Bit Score: 90.43  E-value: 1.23e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGhhrnsnnahrnrppknpklnningnsihskrenkrkhkygfQLKPFNP 80
Cdd:cd19348  183 TCWLQLADFRKVGDLLKEKYDSAAAMRINRKG-----------------------------------------KLELVNS 221

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19348  222 RFNPPTAEDLVYIDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRG 275
Wnt_Wnt5a cd19347
Wnt domain found in protein Wnt-5a and similar proteins; Wnt-5a is a secreted growth factor ...
 1-134 2.82e-22

Wnt domain found in protein Wnt-5a and similar proteins; Wnt-5a is a secreted growth factor that belongs to the noncanonical members of the Wingless-related MMTV-integration family. It can activate or inhibit canonical Wnt signaling, depending on receptor context. Wnt-5a specifically regulates dendritic spine formation in rodent hippocampal neurons, resulting in postsynaptic development that promotes the clustering of the postsynaptic density protein 95 (PSD-95). Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381721  Cd Length: 312  Bit Score: 89.35  E-value: 2.82e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGhhrnsnnahrnrppknpKLNNINGNsihskrenkrkhkygfqlkpFNP 80
Cdd:cd19347  183 TCWLQLADFRKVGDALKEKYDSAAAMKLNSRG-----------------KLVQVNSR--------------------FNP 225

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehkpPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19347  226 ----PTTLDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRG 275
wnt_Wnt7b cd19350
Wnt domain found in protein Wnt-7b and similar proteins; Wnt-7b functions in the canonical Wnt ...
 1-134 2.03e-21

Wnt domain found in protein Wnt-7b and similar proteins; Wnt-7b functions in the canonical Wnt/beta-catenin signaling pathway in vascular smooth muscle cells. It is required for normal fusion of the chorion and the allantois during placenta development. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381724  Cd Length: 318  Bit Score: 86.99  E-value: 2.03e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNsghhrnsnnAHRNRPPKNPKLNNINgnsihskrenkrkhkygfqlkpfnp 80
Cdd:cd19350  182 TCWTTLPKFREIGYVLKEKYNAAVQVEVVR---------ASRLRQPTFLKIKKRR------------------------- 227

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19350  228 SYQKPMETDLVYIERSPNYCEEDAATGSVGTQGRLCNRTSPHTDGCDLMCCGRG 281
Wnt_Wnt2 cd19345
Wnt domain found in protein Wnt-2 and similar proteins; Wnt-2, also called Int-1-like protein ...
 1-134 1.08e-19

Wnt domain found in protein Wnt-2 and similar proteins; Wnt-2, also called Int-1-like protein 1 (INT1L1), or Int-1-related protein (IRP), functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family. It plays an important role in embryonic lung development. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381719  Cd Length: 314  Bit Score: 82.29  E-value: 1.08e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHHRNSNNAHRNRPPKNpklnningnsihskrenkrkhkygfqlkpfnp 80
Cdd:cd19345  184 TCWLAMADFRKTGDYLRKKYNGAIQVVMNQDGTGFTVANKHFKKPTKN-------------------------------- 231

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehkppgvkDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19345  232 --------DLVYFENSPDYCVRDRDAGSLGTAGRVCNRTSRGMDGCEVMCCGRG 277
Wnt_Wnt10b cd19356
Wnt domain found in protein Wnt-10b and similar proteins; Wnt-10b, also called protein Wnt-12, ...
 1-134 5.47e-19

Wnt domain found in protein Wnt-10b and similar proteins; Wnt-10b, also called protein Wnt-12, specifically activates canonical Wnt/beta-catenin signaling and thus triggers beta-catenin/LEF/TCF-mediated transcriptional programs. It is involved in signaling networks controlling stemness, pluripotency and cell fate decisions. Wnt-10b is unique and plays an important role in differentiation of epithelial cells in the hair follicle. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381730  Cd Length: 299  Bit Score: 80.32  E-value: 5.47e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFdgasHVAASNSGHHRNSNNAHRnrppknpklnningnsihskRENKRKHKygfqlkpfnp 80
Cdd:cd19356  170 TCWHVTPEFRLVGALLREKF----QRAIFINSHNKNSGVFLP--------------------RLRPRRLA---------- 215

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehkppgvKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19356  216 -------RELVYFEKSPDFCERDPAVDSPGTQGRICNKTSPGMDGCGSLCCGRG 262
Wnt_Wnt2b cd19346
Wnt domain found in protein Wnt-2b and similar proteins; Wnt-2b, also called protein Wnt-13, ...
 1-134 3.25e-17

Wnt domain found in protein Wnt-2b and similar proteins; Wnt-2b, also called protein Wnt-13, functions in the canonical Wnt/beta-catenin signaling pathway. It plays a redundant role in embryonic lung development. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381720  Cd Length: 314  Bit Score: 75.73  E-value: 3.25e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHHRNSNNAHRNRPPKNpklnningnsihskrenkrkhkygfqlkpfnp 80
Cdd:cd19346  184 TCWLAMSDFRKTGDYLRKRYNGAVQVTMNQDGTGFTVANKNFRKATKT-------------------------------- 231

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehkppgvkDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGRG 134
Cdd:cd19346  232 --------DLVYFENSPDYCVMDKSAGSLGTAGRVCNKSSRGTDGCEVMCCGRG 277
Wnt_Wnt9 cd19341
Wnt domain found in protein Wnt-9a, Wnt-9b and similar proteins; The family includes Wnt-9a ...
 1-134 3.31e-17

Wnt domain found in protein Wnt-9a, Wnt-9b and similar proteins; The family includes Wnt-9a and Wnt-9b, both of which function in the canonical Wnt/beta-catenin signaling pathway. Wnt-9a, also called protein Wnt-14, is required for normal timing of IHH expression during embryonic bone development, normal chondrocyte maturation and for normal bone mineralization during embryonic bone development. Wnt-9a plays a redundant role in maintaining joint integrity. It is a conserved regulator of hematopoietic stem and progenitor cell development. Wnt-9b, also called protein Wnt-14b, or protein Wnt-15, plays a central role in the regulation of mesenchymal to epithelial transitions underlying organogenesis of the mammalian urogenital system. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381715  Cd Length: 299  Bit Score: 75.40  E-value: 3.31e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNsghhrnsnnahrnrppknpklnningnsihskRENKRKHKYGFQLKPFNP 80
Cdd:cd19341  167 TCWKQLAPFNEIGKILKRKYEKAVKVVSEN--------------------------------NAATGGSQLRKGKSGSVK 214

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 EHKPPGVKDLVYYEMSPGFCEKNPKLGiqGTHGRMCNDTsmgvDGCDIMCCGRG 134
Cdd:cd19341  215 KKSRPRRKDLVYLEKSPSFCRSTRYSP--GTKGRRCLKG----DNCDTLCCGRG 262
Wnt_Wnt8 cd19340
Wnt domain found in protein Wnt-8a, Wnt-8b and similar proteins; The family includes Wnt-8a ...
 1-133 5.35e-15

Wnt domain found in protein Wnt-8a, Wnt-8b and similar proteins; The family includes Wnt-8a and Wnt-8b. Wnt-8a, also called protein Wnt-8d, plays a role in embryonic patterning. Wnt-8b may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. It acts as a suppressor of early eye and retinal progenitor formation. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381714  Cd Length: 301  Bit Score: 69.24  E-value: 5.35e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSGHHRNSNNAHRnrppknpKLNNINGNsihskrenkrkhkygfqlkpfnp 80
Cdd:cd19340  161 TCWMQLAPFREIGTDLKRKYDRAVRVDYENGGLRETNGSRAI-------KLLNIKKN----------------------- 210

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 156958840  81 ehkppgvkDLVYYEMSPGFCEKNPKLGIQGTHGRMCN-DTSMGVDGCDIMCCGR 133
Cdd:cd19340  211 --------DLVYLEKSPNYCRANVTLGWPGTLGRQCSrDKKESVSRWERKSCRR 256
Wnt_Wnt9b cd19354
Wnt domain found in protein Wnt-9b and similar proteins; Wnt-9b, also called protein Wnt-14b ...
 1-134 8.89e-13

Wnt domain found in protein Wnt-9b and similar proteins; Wnt-9b, also called protein Wnt-14b or Wnt-15, functions in the canonical Wnt/beta-catenin signaling pathway. It plays a central role in the regulation of mesenchymal to epithelial transitions underlying organogenesis of the mammalian urogenital system. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381728  Cd Length: 297  Bit Score: 63.38  E-value: 8.89e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVaasnsghHRNSNNAhrnrppknpklnningnSIHSKRENKRKHKYGFQlkpfnp 80
Cdd:cd19354  164 TCWKQLSPFHETGRLLKLKYENAVKV-------HSVTNDA-----------------TGETELWSPERHGHTLK------ 213

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 156958840  81 eHKPPGVKDLVYYEMSPGFCEknPKLGIQGTHGRMCN-DTSmgvdgCDIMCCGRG 134
Cdd:cd19354  214 -GHSPRSTDLVYLEDSPSFCR--PSKYSPGTAGRTCSrETN-----CDSLCCGRG 260
Wnt_Wnt8a cd19351
Wnt domain found in protein Wnt-8a and similar proteins; Wnt-8a, also called protein Wnt-8d, ...
 1-133 7.50e-08

Wnt domain found in protein Wnt-8a and similar proteins; Wnt-8a, also called protein Wnt-8d, plays a role in embryonic patterning. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381725  Cd Length: 307  Bit Score: 49.52  E-value: 7.50e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGAshvaasnsghHRNSNNAHRNRppknpklnniNGNSIHSKrenkrkhkyGFQLKPFNP 80
Cdd:cd19351  163 TCWLQLADFREIGNYLKVKHDQA----------LKLEMDKRRMR----------AGNSADNR---------GAIAEAFGS 213

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 156958840  81 EHKppgvKDLVYYEMSPGFCEKNPKLGIQGTHGRMCNDTSMGVDGCDIMCCGR 133
Cdd:cd19351  214 VAE----TELIYLEDSPDYCTKNASLGLQGTEGRECLQSGKNLSQWERRSCRR 262
Wnt_Wnt8b cd19352
Wnt domain found in protein Wnt-8b and similar proteins; Wnt-8b may play an important role in ...
 1-116 5.36e-07

Wnt domain found in protein Wnt-8b and similar proteins; Wnt-8b may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. It acts as a suppressor of early eye and retinal progenitor formation. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381726  Cd Length: 305  Bit Score: 46.94  E-value: 5.36e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVaasnsghhrnsnnahrnrppknpKLNNINGNSIHSKrenkrkhkyGFQLKPFNP 80
Cdd:cd19352  164 TCWLQLPEFREVGNYLKEKYHRALKV-----------------------DLLQGAGNSAASR---------GAIAETFRS 211

                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 156958840  81 EHKppgvKDLVYYEMSPGFCEKNPKLGIQGTHGRMC 116
Cdd:cd19352  212 ISK----KELVHLEDSPDYCLENKTLGLLGTEGREC 243
Wnt_Wnt9a cd19353
Wnt domain found in protein Wnt-9a and similar proteins; Wnt-9a, also called protein Wnt-14, ...
 1-134 8.86e-07

Wnt domain found in protein Wnt-9a and similar proteins; Wnt-9a, also called protein Wnt-14, functions in the canonical Wnt/beta-catenin signaling pathway. It is required for normal timing of IHH expression during embryonic bone development, normal chondrocyte maturation and for normal bone mineralization during embryonic bone development. Wnt-9a plays a redundant role in maintaining joint integrity. It is a conserved regulator of hematopoietic stem and progenitor cell development. Wnt genes have been identified in vertebrates and invertebrates, but not in plants, unicellular eukaryotes, or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families. The Wnt signaling mediated by Wnt proteins that orchestrate and influence a myriad of cellular processes, such as cell proliferation, differentiation, tumorigenesis, apoptosis, and participation in immune defense during microbe infection.


Pssm-ID: 381727  Cd Length: 298  Bit Score: 46.57  E-value: 8.86e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156958840   1 TCWMRLPPFRVIGDLLKDRFDGASHVAASNSghhrNSNNAHRNRPPKNPklnnINGNSihskrenkrkhkygfqlkpfnp 80
Cdd:cd19353  165 TCWRQLSPFHEIGKQLKQKYETSLKVGSTTN----EATGEGDISPPKKS----GAGHS---------------------- 214

                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 156958840  81 eHKPPGVKDLVYYEMSPGFC---EKNPklgiqGTHGRMCNDTSmgvdGCDIMCCGRG 134
Cdd:cd19353  215 -DQIPRTTDLVYIDDSPSFClmsRFSP-----GTSGRRCYKDK----NCESICCGRG 261
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH