NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|241913449|pdb|3HGL|A]
View 

Chain A, Effector protein hopAB2

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
HopAB_PID cd12802
Pto-interacting domain of the HopAB family of Type III Effector proteins; HopAB family members ...
 4-82 2.05e-35

Pto-interacting domain of the HopAB family of Type III Effector proteins; HopAB family members are type III effector proteins that are secreted by the plant pathogen Pseudomonas syringae into the host plant to inhibit its immune system and facilitate the spread of the pathogen. AvrPtoB, also called HopAB3, is the best studied member of the family. It suppresses host basal defenses by interfering with PAMP (pathogen-associated molecular signature)-triggered immunity (PTI) through binding and inhibiting BAK1, a kinase which serves to activate defense signaling. It also recognizes the kinase Pto to activate effector-triggered immunity (ETI). AvrPtoB contains an N-terminal region that contains two kinase-interacting domains (KID) and a C-terminal E3 ligase domain. The first KID recognizes the PTI-associated kinase Bti9 as well as Pto, and is referred to as the Pto-binding domain (PID). The second KID interacts with BAK1 and FLS2, which are leucine-rich repeat-containing receptor-like kinases, and is called the BAK1-interacting domain (BID). This family also contains a unique member, HopPmaL, which is shorter and lacks the C-terminal E3 ligase domain.


:

Pssm-ID: 214001  Cd Length: 79  Bit Score: 114.94  E-value: 2.05e-35
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
3HGL_A       4 GAVAHANSIVQQLVSEGADISHTRN*LRNA*NGDAVAFSRVEQNIFRQHFPN*P*HGISRDSELAIELRGALRRAVHQQ 82
Cdd:cd12802  1 GAVPHANRIVQQLVEAGADLANIRTMLRNAMNGDAVALSRVEQNILRQHFPNMLMCGISRDSELAIALREALRRAVRQQ 79
 
Name Accession Description Interval E-value
HopAB_PID cd12802
Pto-interacting domain of the HopAB family of Type III Effector proteins; HopAB family members ...
 4-82 2.05e-35

Pto-interacting domain of the HopAB family of Type III Effector proteins; HopAB family members are type III effector proteins that are secreted by the plant pathogen Pseudomonas syringae into the host plant to inhibit its immune system and facilitate the spread of the pathogen. AvrPtoB, also called HopAB3, is the best studied member of the family. It suppresses host basal defenses by interfering with PAMP (pathogen-associated molecular signature)-triggered immunity (PTI) through binding and inhibiting BAK1, a kinase which serves to activate defense signaling. It also recognizes the kinase Pto to activate effector-triggered immunity (ETI). AvrPtoB contains an N-terminal region that contains two kinase-interacting domains (KID) and a C-terminal E3 ligase domain. The first KID recognizes the PTI-associated kinase Bti9 as well as Pto, and is referred to as the Pto-binding domain (PID). The second KID interacts with BAK1 and FLS2, which are leucine-rich repeat-containing receptor-like kinases, and is called the BAK1-interacting domain (BID). This family also contains a unique member, HopPmaL, which is shorter and lacks the C-terminal E3 ligase domain.


Pssm-ID: 214001  Cd Length: 79  Bit Score: 114.94  E-value: 2.05e-35
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
3HGL_A       4 GAVAHANSIVQQLVSEGADISHTRN*LRNA*NGDAVAFSRVEQNIFRQHFPN*P*HGISRDSELAIELRGALRRAVHQQ 82
Cdd:cd12802  1 GAVPHANRIVQQLVEAGADLANIRTMLRNAMNGDAVALSRVEQNILRQHFPNMLMCGISRDSELAIALREALRRAVRQQ 79
 
Name Accession Description Interval E-value
HopAB_PID cd12802
Pto-interacting domain of the HopAB family of Type III Effector proteins; HopAB family members ...
 4-82 2.05e-35

Pto-interacting domain of the HopAB family of Type III Effector proteins; HopAB family members are type III effector proteins that are secreted by the plant pathogen Pseudomonas syringae into the host plant to inhibit its immune system and facilitate the spread of the pathogen. AvrPtoB, also called HopAB3, is the best studied member of the family. It suppresses host basal defenses by interfering with PAMP (pathogen-associated molecular signature)-triggered immunity (PTI) through binding and inhibiting BAK1, a kinase which serves to activate defense signaling. It also recognizes the kinase Pto to activate effector-triggered immunity (ETI). AvrPtoB contains an N-terminal region that contains two kinase-interacting domains (KID) and a C-terminal E3 ligase domain. The first KID recognizes the PTI-associated kinase Bti9 as well as Pto, and is referred to as the Pto-binding domain (PID). The second KID interacts with BAK1 and FLS2, which are leucine-rich repeat-containing receptor-like kinases, and is called the BAK1-interacting domain (BID). This family also contains a unique member, HopPmaL, which is shorter and lacks the C-terminal E3 ligase domain.


Pssm-ID: 214001  Cd Length: 79  Bit Score: 114.94  E-value: 2.05e-35
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
3HGL_A       4 GAVAHANSIVQQLVSEGADISHTRN*LRNA*NGDAVAFSRVEQNIFRQHFPN*P*HGISRDSELAIELRGALRRAVHQQ 82
Cdd:cd12802  1 GAVPHANRIVQQLVEAGADLANIRTMLRNAMNGDAVALSRVEQNILRQHFPNMLMCGISRDSELAIALREALRRAVRQQ 79
HopAB_KID cd12801
Kinase-interacting domains of the HopAB family of Type III Effector proteins; HopAB family ...
 5-80 1.02e-20

Kinase-interacting domains of the HopAB family of Type III Effector proteins; HopAB family members are type III effector proteins that are secreted by the plant pathogen Pseudomonas syringae into the host plant to inhibit its immune system and facilitate the spread of the pathogen. AvrPtoB, also called HopAB3, is the best studied member of the family. It suppresses host basal defenses by interfering with PAMP (pathogen-associated molecular signature)-triggered immunity (PTI) through binding and inhibiting BAK1, a kinase which serves to activate defense signaling. It also recognizes the kinase Pto to activate effector-triggered immunity (ETI). AvrPtoB contains an N-terminal region that contains two kinase-interacting domains (KID) and a C-terminal E3 ligase domain. The first KID recognizes the PTI-associated kinase Bti9 as well as Pto, and is referred to as the Pto-binding domain (PID). The second KID interacts with BAK1 and FLS2, which are leucine-rich repeat-containing receptor-like kinases, and is called the BAK1-interacting domain (BID). This family also contains a unique member, HopPmaL, which is shorter and lacks the C-terminal E3 ligase domain.


Pssm-ID: 214000  Cd Length: 77  Bit Score: 77.79  E-value: 1.02e-20
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
3HGL_A       5 AVAHANSIVQQLVSEGADISHTRN*LRNA*NGDAVAFSRvEQNIFRQ--HFPN*P*HGISRDSELAIELRGALRRAVH 80
Cdd:cd12801  1 AVPRANRILQQLVQAGADLERLRTALRNYMMGDAPIPSD-IRRALRQvgIFPNIPMEGISLVSHPALNLREALRRALS 77
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH