NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS58289.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58289.1 Public Homo sapiens 12 CDK2AP1 24 110 108 CCDS HistoryNCBI Gene:8099Re-query CCDS DB by CCDS ID:58289.1Re-query CCDS DB by GeneID:8099See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58289.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000544658.5 ENSP00000438561.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000544658.5Link to Ensembl Protein Viewer:ENSP00000438561.1Re-query CCDS DB by Nucleotide ID:ENST00000544658Re-query CCDS DB by Protein ID:ENSP00000438561
Original member Current member EBI ENST00000542174.5 ENSP00000440729.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000542174.5Link to Ensembl Protein Viewer:ENSP00000440729.1Re-query CCDS DB by Nucleotide ID:ENST00000542174Re-query CCDS DB by Protein ID:ENSP00000440729
Original member Current member EBI ENST00000538446.5 ENSP00000442502.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000538446.5Link to Ensembl Protein Viewer:ENSP00000442502.1Re-query CCDS DB by Nucleotide ID:ENST00000538446Re-query CCDS DB by Protein ID:ENSP00000442502
Original member Current member EBI ENST00000535979.5 ENSP00000442565.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000535979.5Link to Ensembl Protein Viewer:ENSP00000442565.1Re-query CCDS DB by Nucleotide ID:ENST00000535979Re-query CCDS DB by Protein ID:ENSP00000442565
Original member Current member EBI ENST00000618072.4 ENSP00000479982.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000618072.4Link to Ensembl Protein Viewer:ENSP00000479982.1Re-query CCDS DB by Nucleotide ID:ENST00000618072Re-query CCDS DB by Protein ID:ENSP00000479982
Original member Current member EBI ENST00000652466.1 ENSP00000498286.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000652466.1Link to Ensembl Protein Viewer:ENSP00000498286.1Re-query CCDS DB by Nucleotide ID:ENST00000652466Re-query CCDS DB by Protein ID:ENSP00000498286
Original member Current member NCBI NM_001270433.2 NP_001257362.1 Accepted alive Link to Nucleotide Sequence:NM_001270433.2Link to Protein Sequence:NP_001257362.1Re-query CCDS DB by Nucleotide ID:NM_001270433Re-query CCDS DB by Protein ID:NP_001257362Link to BLAST:NP_001257362.1
Original member Current member NCBI NM_001270434.2 NP_001257363.1 Accepted alive Link to Nucleotide Sequence:NM_001270434.2Link to Protein Sequence:NP_001257363.1Re-query CCDS DB by Nucleotide ID:NM_001270434Re-query CCDS DB by Protein ID:NP_001257363Link to BLAST:NP_001257363.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001257362.1 87 O14519-2 87 100% 0 0
NP_001257363.1 87 O14519-2 87 100% 0 0

Chromosomal Locations for CCDS 58289.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 123261736 123261803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 123265196 123265322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 123267185 123267253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (264 nt):
ATGGCAACGTCTTCACAGTACCGCCAGCTGCTCAGTGACTACGGGCCACCGTCCCTAGGCTACACCCAGG
GAACTGGGAACAGCCAGGTGCCCCAAAGCAAATACGCGGAGCTGCTGGCCATCATTGAAGAGCTGGGGAA
GGAGATCAGACCCACGTACGCAGGGAGCAAGAGTGCCATGGAGAGGCTGAAGCGCGGCATCATTCACGCT
AGAGGACTGGTTCGGGAGTGCTTGGCAGAAACGGAACGGAATGCCAGATCCTAG

Translation (87 aa):
MATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHA
RGLVRECLAETERNARS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH