NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS47205.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47205.1 Public Homo sapiens 5 MOCS2 24 110 108 CCDS HistoryNCBI Gene:4338Re-query CCDS DB by CCDS ID:47205.1Re-query CCDS DB by GeneID:4338See the combined annotation on chromosome 5 in Sequence Viewer

Public Note for CCDS 47205.1
This CCDS ID represents the protein described in PMIDs: 10053003, 16737835 and 9889283. This transcript is supported by BC095417.1. It should be noted this transcript is predicted to undergo nonsense-mediated mRNA decay (NMD). However, the protein is represented because it was detected endogenously in PMID: 10053003 and 16737835.

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 47205.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000361377.8 ENSP00000355160.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000361377.8Link to Ensembl Protein Viewer:ENSP00000355160.4Re-query CCDS DB by Nucleotide ID:ENST00000361377Re-query CCDS DB by Protein ID:ENSP00000355160
Original member Current member EBI ENST00000450852.8 ENSP00000411022.3 MANE Plus Clinical Accepted alive Link to Ensembl Transcript Viewer:ENST00000450852.8Link to Ensembl Protein Viewer:ENSP00000411022.3Re-query CCDS DB by Nucleotide ID:ENST00000450852Re-query CCDS DB by Protein ID:ENSP00000411022
Original member Current member EBI ENST00000510818.6 ENSP00000424267.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000510818.6Link to Ensembl Protein Viewer:ENSP00000424267.2Re-query CCDS DB by Nucleotide ID:ENST00000510818Re-query CCDS DB by Protein ID:ENSP00000424267
Original member Current member EBI ENST00000508922.5 ENSP00000426274.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000508922.5Link to Ensembl Protein Viewer:ENSP00000426274.1Re-query CCDS DB by Nucleotide ID:ENST00000508922Re-query CCDS DB by Protein ID:ENSP00000426274
Original member Current member EBI ENST00000582677.5 ENSP00000462870.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000582677.5Link to Ensembl Protein Viewer:ENSP00000462870.1Re-query CCDS DB by Nucleotide ID:ENST00000582677Re-query CCDS DB by Protein ID:ENSP00000462870
Original member Current member EBI ENST00000584946.5 ENSP00000464663.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000584946.5Link to Ensembl Protein Viewer:ENSP00000464663.1Re-query CCDS DB by Nucleotide ID:ENST00000584946Re-query CCDS DB by Protein ID:ENSP00000464663
Original member Current member NCBI NM_176806.4 NP_789776.1 MANE Plus Clinical Accepted alive Link to Nucleotide Sequence:NM_176806.4Link to Protein Sequence:NP_789776.1Re-query CCDS DB by Nucleotide ID:NM_176806Re-query CCDS DB by Protein ID:NP_789776Link to BLAST:NP_789776.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_789776.1 88 O96033 88 100% 0 0

Chromosomal Locations for CCDS 47205.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 53107095 53107221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53108522 53108643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53109712 53109729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (267 nt):
ATGGTGCCGCTGTGCCAGGTTGAAGTATTGTATTTTGCAAAAAGTGCTGAAATAACAGGAGTTCGTTCAG
AGACCATTTCTGTGCCTCAAGAAATAAAAGCGTTGCAGCTGTGGAAGGAGATAGAAACTCGACATCCTGG
ATTGGCTGATGTTAGAAATCAGATAATATTTGCTGTTCGTCAAGAATATGTCGAGCTTGGAGATCAGCTC
CTCGTGCTTCAGCCTGGAGACGAAATTGCCGTTATCCCCCCCATTAGTGGAGGATAG

Translation (88 aa):
MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQL
LVLQPGDEIAVIPPISGG


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH