NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS3264.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3264.1 Public Homo sapiens 3 POLR2H 24 110 108 CCDS HistoryNCBI Gene:5437Re-query CCDS DB by CCDS ID:3264.1Re-query CCDS DB by GeneID:5437See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3264.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000456318.6 ENSP00000392913.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000456318.6Link to Ensembl Protein Viewer:ENSP00000392913.1Re-query CCDS DB by Nucleotide ID:ENST00000456318Re-query CCDS DB by Protein ID:ENSP00000392913
Original member Current member NCBI NM_001389576.1 NP_001376505.1 Accepted alive Link to Nucleotide Sequence:NM_001389576.1Link to Protein Sequence:NP_001376505.1Re-query CCDS DB by Nucleotide ID:NM_001389576Re-query CCDS DB by Protein ID:NP_001376505Link to BLAST:NP_001376505.1
Original member Current member NCBI NM_001389578.1 NP_001376507.1 Accepted alive Link to Nucleotide Sequence:NM_001389578.1Link to Protein Sequence:NP_001376507.1Re-query CCDS DB by Nucleotide ID:NM_001389578Re-query CCDS DB by Protein ID:NP_001376507Link to BLAST:NP_001376507.1
Original member Current member NCBI NM_001389579.1 NP_001376508.1 Accepted alive Link to Nucleotide Sequence:NM_001389579.1Link to Protein Sequence:NP_001376508.1Re-query CCDS DB by Nucleotide ID:NM_001389579Re-query CCDS DB by Protein ID:NP_001376508Link to BLAST:NP_001376508.1
Original member Current member NCBI NM_001389581.1 NP_001376510.1 Accepted alive Link to Nucleotide Sequence:NM_001389581.1Link to Protein Sequence:NP_001376510.1Re-query CCDS DB by Nucleotide ID:NM_001389581Re-query CCDS DB by Protein ID:NP_001376510Link to BLAST:NP_001376510.1
Original member Current member NCBI NM_001389582.1 NP_001376511.1 Accepted alive Link to Nucleotide Sequence:NM_001389582.1Link to Protein Sequence:NP_001376511.1Re-query CCDS DB by Nucleotide ID:NM_001389582Re-query CCDS DB by Protein ID:NP_001376511Link to BLAST:NP_001376511.1
Original member Current member NCBI NM_001389583.1 NP_001376512.1 Accepted alive Link to Nucleotide Sequence:NM_001389583.1Link to Protein Sequence:NP_001376512.1Re-query CCDS DB by Nucleotide ID:NM_001389583Re-query CCDS DB by Protein ID:NP_001376512Link to BLAST:NP_001376512.1
Original member Current member NCBI NM_001389584.1 NP_001376513.1 Accepted alive Link to Nucleotide Sequence:NM_001389584.1Link to Protein Sequence:NP_001376513.1Re-query CCDS DB by Nucleotide ID:NM_001389584Re-query CCDS DB by Protein ID:NP_001376513Link to BLAST:NP_001376513.1
Original member Current member NCBI NM_006232.5 NP_006223.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_006232.5Link to Protein Sequence:NP_006223.2Re-query CCDS DB by Nucleotide ID:NM_006232Re-query CCDS DB by Protein ID:NP_006223Link to BLAST:NP_006223.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001376505.1 150 P52434-1 150 100% 0 0
NP_001376507.1 150 P52434-1 150 100% 0 0
NP_001376508.1 150 P52434-1 150 100% 0 0
NP_001376510.1 150 P52434-1 150 100% 0 0
NP_001376511.1 150 P52434-1 150 100% 0 0
NP_001376512.1 150 P52434-1 150 100% 0 0
NP_001376513.1 150 P52434-1 150 100% 0 0
NP_006223.2 150 P52434-1 150 100% 0 0

Chromosomal Locations for CCDS 3264.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 184363493 184363565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184364966 184365049 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184365133 184365226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184366717 184366800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184368177 184368294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (453 nt):
ATGGCGGGCATCCTGTTTGAGGATATTTTCGATGTGAAGGATATTGACCCGGAGGGCAAGAAGTTTGACC
GAGTGTCTCGACTGCATTGTGAGAGTGAATCTTTCAAGATGGATCTAATCTTAGATGTAAACATTCAAAT
TTACCCTGTAGACTTGGGTGACAAGTTTCGGTTGGTCATAGCTAGTACCTTGTATGAAGATGGTACCCTG
GATGATGGTGAATACAACCCCACTGATGATAGGCCTTCCAGGGCTGACCAGTTTGAGTATGTAATGTATG
GAAAAGTGTACAGGATTGAGGGAGATGAAACTTCTACTGAAGCAGCAACACGCCTCTCTGCGTACGTGTC
CTATGGGGGCCTGCTCATGAGGCTGCAGGGGGATGCCAACAACCTGCATGGATTCGAGGTGGACTCCAGA
GTTTATCTCCTGATGAAGAAGCTAGCCTTCTGA

Translation (150 aa):
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTL
DDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSR
VYLLMKKLAF


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH