NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS28283.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28283.1 Public Mus musculus 16 Atp5pf 23 108 98 CCDS HistoryNCBI Gene:11957Re-query CCDS DB by CCDS ID:28283.1Re-query CCDS DB by GeneID:11957See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28283.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000023608.13 ENSMUSP00000023608.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023608.13Link to Ensembl Protein Viewer:ENSMUSP00000023608.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000023608Re-query CCDS DB by Protein ID:ENSMUSP00000023608
Original member Current member EBI ENSMUST00000114191.7 ENSMUSP00000109829.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114191.7Link to Ensembl Protein Viewer:ENSMUSP00000109829.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000114191Re-query CCDS DB by Protein ID:ENSMUSP00000109829
Original member Current member EBI ENSMUST00000114193.7 ENSMUSP00000109831.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114193.7Link to Ensembl Protein Viewer:ENSMUSP00000109831.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000114193Re-query CCDS DB by Protein ID:ENSMUSP00000109831
Original member NCBI NM_001302213.1 NP_001289142.1 Updated not alive Link to Nucleotide Sequence:NM_001302213.1Link to Protein Sequence:NP_001289142.1Re-query CCDS DB by Nucleotide ID:NM_001302213Re-query CCDS DB by Protein ID:NP_001289142
Current member NCBI NM_001302213.2 NP_001289142.1 Accepted alive Link to Nucleotide Sequence:NM_001302213.2Link to Protein Sequence:NP_001289142.1Re-query CCDS DB by Nucleotide ID:NM_001302213Re-query CCDS DB by Protein ID:NP_001289142Link to BLAST:NP_001289142.1
Original member NCBI NM_001302214.1 NP_001289143.1 Updated not alive Link to Nucleotide Sequence:NM_001302214.1Link to Protein Sequence:NP_001289143.1Re-query CCDS DB by Nucleotide ID:NM_001302214Re-query CCDS DB by Protein ID:NP_001289143
Current member NCBI NM_001302214.2 NP_001289143.1 Accepted alive Link to Nucleotide Sequence:NM_001302214.2Link to Protein Sequence:NP_001289143.1Re-query CCDS DB by Nucleotide ID:NM_001302214Re-query CCDS DB by Protein ID:NP_001289143Link to BLAST:NP_001289143.1
Original member NCBI NM_001302215.1 NP_001289144.1 Updated not alive Link to Nucleotide Sequence:NM_001302215.1Link to Protein Sequence:NP_001289144.1Re-query CCDS DB by Nucleotide ID:NM_001302215Re-query CCDS DB by Protein ID:NP_001289144
Current member NCBI NM_001302215.2 NP_001289144.1 Accepted alive Link to Nucleotide Sequence:NM_001302215.2Link to Protein Sequence:NP_001289144.1Re-query CCDS DB by Nucleotide ID:NM_001302215Re-query CCDS DB by Protein ID:NP_001289144Link to BLAST:NP_001289144.1
Original member NCBI NM_001302216.1 NP_001289145.1 Updated not alive Link to Nucleotide Sequence:NM_001302216.1Link to Protein Sequence:NP_001289145.1Re-query CCDS DB by Nucleotide ID:NM_001302216Re-query CCDS DB by Protein ID:NP_001289145
Current member NCBI NM_001302216.2 NP_001289145.1 Accepted alive Link to Nucleotide Sequence:NM_001302216.2Link to Protein Sequence:NP_001289145.1Re-query CCDS DB by Nucleotide ID:NM_001302216Re-query CCDS DB by Protein ID:NP_001289145Link to BLAST:NP_001289145.1
Original member NCBI NM_001358499.1 NP_001345428.1 Updated not alive Link to Nucleotide Sequence:NM_001358499.1Link to Protein Sequence:NP_001345428.1Re-query CCDS DB by Nucleotide ID:NM_001358499Re-query CCDS DB by Protein ID:NP_001345428
Current member NCBI NM_001358499.2 NP_001345428.1 Accepted alive Link to Nucleotide Sequence:NM_001358499.2Link to Protein Sequence:NP_001345428.1Re-query CCDS DB by Nucleotide ID:NM_001358499Re-query CCDS DB by Protein ID:NP_001345428Link to BLAST:NP_001345428.1
Original member NCBI NM_001358500.1 NP_001345429.1 Updated not alive Link to Nucleotide Sequence:NM_001358500.1Link to Protein Sequence:NP_001345429.1Re-query CCDS DB by Nucleotide ID:NM_001358500Re-query CCDS DB by Protein ID:NP_001345429
Current member NCBI NM_001358500.2 NP_001345429.1 Accepted alive Link to Nucleotide Sequence:NM_001358500.2Link to Protein Sequence:NP_001345429.1Re-query CCDS DB by Nucleotide ID:NM_001358500Re-query CCDS DB by Protein ID:NP_001345429Link to BLAST:NP_001345429.1
Original member NCBI NM_016755.3 NP_058035.1 Updated not alive Link to Nucleotide Sequence:NM_016755.3Link to Protein Sequence:NP_058035.1Re-query CCDS DB by Nucleotide ID:NM_016755Re-query CCDS DB by Protein ID:NP_058035
Current member NCBI NM_016755.4 NP_058035.1 Accepted alive Link to Nucleotide Sequence:NM_016755.4Link to Protein Sequence:NP_058035.1Re-query CCDS DB by Nucleotide ID:NM_016755Re-query CCDS DB by Protein ID:NP_058035Link to BLAST:NP_058035.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001289142.1 108 P97450 108 100% 0 0
NP_001289143.1 108 P97450 108 100% 0 0
NP_001289144.1 108 P97450 108 100% 0 0
NP_001289145.1 108 P97450 108 100% 0 0
NP_001345428.1 108 P97450 108 100% 0 0
NP_001345429.1 108 P97450 108 100% 0 0
NP_058035.1 108 P97450 108 100% 0 0

Chromosomal Locations for CCDS 28283.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 84827958 84827995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84828425 84828549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84831329 84831492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (327 nt):
ATGGTTCTGCAGAGGATCTTCAGGCTCTCCTCTGTCCTTCGGTCAGCAGTCTCTGTGCATTTGAAGAGGA
ACATTGGTGTTACAGCTGTGGCCTTTAATAAGGAACTTGATCCTGTACAGAAACTCTTCGTGGACAAGAT
AAGAGAGTACAAATCAAAGCGACAGGCATCTGGAGGACCTGTTGATATTGGCCCAGAGTATCAGCAAGAT
CTGGACAGAGAGCTTTATAAGCTTAAACAAATGTATGGTAAAGGAGAGATGGATACATTTCCTACCTTCA
AATTTGATGATCCCAAATTTGAAGTCATCGACAAACCCCAGTCCTGA

Translation (108 aa):
MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGPVDIGPEYQQD
LDRELYKLKQMYGKGEMDTFPTFKFDDPKFEVIDKPQS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH