NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS22008.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22008.1 Public Mus musculus 7 Tmem80 23 108 98 CCDS HistoryNCBI Gene:71448Re-query CCDS DB by CCDS ID:22008.1Re-query CCDS DB by GeneID:71448See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22008.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000026578.13 ENSMUSP00000026578.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026578.13Link to Ensembl Protein Viewer:ENSMUSP00000026578.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000026578Re-query CCDS DB by Protein ID:ENSMUSP00000026578
Original member Current member EBI ENSMUST00000133012.7 ENSMUSP00000116695.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000133012.7Link to Ensembl Protein Viewer:ENSMUSP00000116695.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000133012Re-query CCDS DB by Protein ID:ENSMUSP00000116695
Original member Current member EBI ENSMUST00000132061.1 ENSMUSP00000118223.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000132061.1Link to Ensembl Protein Viewer:ENSMUSP00000118223.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000132061Re-query CCDS DB by Protein ID:ENSMUSP00000118223
Original member Current member EBI ENSMUST00000126510.7 ENSMUSP00000123330.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000126510.7Link to Ensembl Protein Viewer:ENSMUSP00000123330.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000126510Re-query CCDS DB by Protein ID:ENSMUSP00000123330
Original member NCBI NM_001141950.1 NP_001135422.1 Updated not alive Link to Nucleotide Sequence:NM_001141950.1Link to Protein Sequence:NP_001135422.1Re-query CCDS DB by Nucleotide ID:NM_001141950Re-query CCDS DB by Protein ID:NP_001135422
Current member NCBI NM_001141950.2 NP_001135422.1 Accepted alive Link to Nucleotide Sequence:NM_001141950.2Link to Protein Sequence:NP_001135422.1Re-query CCDS DB by Nucleotide ID:NM_001141950Re-query CCDS DB by Protein ID:NP_001135422Link to BLAST:NP_001135422.1
Original member NCBI NM_027797.3 NP_082073.1 Updated not alive Link to Nucleotide Sequence:NM_027797.3Link to Protein Sequence:NP_082073.1Re-query CCDS DB by Nucleotide ID:NM_027797Re-query CCDS DB by Protein ID:NP_082073
Current member NCBI NM_027797.4 NP_082073.1 Accepted alive Link to Nucleotide Sequence:NM_027797.4Link to Protein Sequence:NP_082073.1Re-query CCDS DB by Nucleotide ID:NM_027797Re-query CCDS DB by Protein ID:NP_082073Link to BLAST:NP_082073.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001135422.1 123 Q9D3H0-1 123 100% 0 0
NP_082073.1 123 Q9D3H0-1 123 100% 0 0

Chromosomal Locations for CCDS 22008.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 141333659 141333731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 141334011 141334103 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 141335845 141336050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (372 nt):
ATGCTGTTTCACCTCAGTGGGCTGTACTCTGCCCTGTACTTCCTAGCTACACTCCTGATGATTGTATACA
AAAGTCAGGTTTTCAGCTATCCTTGTAACTGTCTGGCCCTGGATCTGGTTCTCTTGCTTCTGATGGGAAT
TCTCAAAGTAGCTCAGCTCTACCTAGGCACAAAAGGCAACCTGATGGAGGCTGAAGTGCCACTGGCTGCC
AGCCTGGCATTCACAGCAGTCGGTGGCCTCCTTTCTGTTCACTTCCTACTCTGGCAGACCTTGGTACTGT
GGATGGACTCGGTCCTCAGCACCGTTCTCCTGGTGCTGCATGGGCTGGAGGCTGGCCTGCAAGTGGTGGT
CATTGCTGACTTCATCAGGTAG

Translation (123 aa):
MLFHLSGLYSALYFLATLLMIVYKSQVFSYPCNCLALDLVLLLLMGILKVAQLYLGTKGNLMEAEVPLAA
SLAFTAVGGLLSVHFLLWQTLVLWMDSVLSTVLLVLHGLEAGLQVVVIADFIR


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH