NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS33550.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33550.1 Public Homo sapiens 21 SMIM11 24 110 108 CCDS HistoryNCBI Gene:54065Re-query CCDS DB by CCDS ID:33550.1See the combined annotation on chromosome 21 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 33550.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000399292.8 ENSP00000382231.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000399292.8Link to Ensembl Protein Viewer:ENSP00000382231.4Re-query CCDS DB by Nucleotide ID:ENST00000399292Re-query CCDS DB by Protein ID:ENSP00000382231
Original member Current member EBI ENST00000399295.2 ENSP00000382234.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000399295.2Link to Ensembl Protein Viewer:ENSP00000382234.2Re-query CCDS DB by Nucleotide ID:ENST00000399295Re-query CCDS DB by Protein ID:ENSP00000382234
Original member Current member EBI ENST00000474455.1 ENSP00000498771.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000474455.1Link to Ensembl Protein Viewer:ENSP00000498771.1Re-query CCDS DB by Nucleotide ID:ENST00000474455Re-query CCDS DB by Protein ID:ENSP00000498771
Original member Current member EBI ENST00000652570.1 ENSP00000499160.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000652570.1Link to Ensembl Protein Viewer:ENSP00000499160.1Re-query CCDS DB by Nucleotide ID:ENST00000652570Re-query CCDS DB by Protein ID:ENSP00000499160
Original member Current member NCBI NM_001376899.1 NP_001363828.1 Accepted alive Link to Nucleotide Sequence:NM_001376899.1Link to Protein Sequence:NP_001363828.1Re-query CCDS DB by Nucleotide ID:NM_001376899Re-query CCDS DB by Protein ID:NP_001363828Link to BLAST:NP_001363828.1
Original member Current member NCBI NM_058182.5 NP_478062.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_058182.5Link to Protein Sequence:NP_478062.1Re-query CCDS DB by Nucleotide ID:NM_058182Re-query CCDS DB by Protein ID:NP_478062Link to BLAST:NP_478062.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001363828.1 58 P58511 58 100% 0 0
NP_478062.1 58 P58511 58 100% 0 0

Chromosomal Locations for CCDS 33550.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 34379505 34379516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 34385478 34385642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (177 nt):
ATGAATTGGAAGGTTCTTGAGCACGTGCCCCTGCTGCTGTATATCTTGGCAGCAAAAACATTAATTCTCT
GCCTGACATTTGCTGGGGTGAAAATGTATCAAAGAAAAAGGTTGGAGGCAAAACAACAAAAACTGGAGGC
TGAAAGGAAGAAGCAATCAGAGAAAAAAGATAACTGA

Translation (58 aa):
MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH