NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS4275.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4275.1 Public Homo sapiens 5 FGF1 24 110 108 CCDS HistoryNCBI Gene:2246Re-query CCDS DB by CCDS ID:4275.1Re-query CCDS DB by GeneID:2246See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4275.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000337706.7 ENSP00000338548.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000337706.7Link to Ensembl Protein Viewer:ENSP00000338548.2Re-query CCDS DB by Nucleotide ID:ENST00000337706Re-query CCDS DB by Protein ID:ENSP00000338548
Original member Current member EBI ENST00000359370.10 ENSP00000352329.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000359370.10Link to Ensembl Protein Viewer:ENSP00000352329.6Re-query CCDS DB by Nucleotide ID:ENST00000359370Re-query CCDS DB by Protein ID:ENSP00000352329
Original member Current member EBI ENST00000378046.5 ENSP00000367285.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378046.5Link to Ensembl Protein Viewer:ENSP00000367285.1Re-query CCDS DB by Nucleotide ID:ENST00000378046Re-query CCDS DB by Protein ID:ENSP00000367285
Original member Current member EBI ENST00000419524.6 ENSP00000396195.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000419524.6Link to Ensembl Protein Viewer:ENSP00000396195.2Re-query CCDS DB by Nucleotide ID:ENST00000419524Re-query CCDS DB by Protein ID:ENSP00000396195
Original member Current member EBI ENST00000441680.6 ENSP00000404742.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000441680.6Link to Ensembl Protein Viewer:ENSP00000404742.2Re-query CCDS DB by Nucleotide ID:ENST00000441680Re-query CCDS DB by Protein ID:ENSP00000404742
Original member Current member EBI ENST00000612258.4 ENSP00000479024.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000612258.4Link to Ensembl Protein Viewer:ENSP00000479024.1Re-query CCDS DB by Nucleotide ID:ENST00000612258Re-query CCDS DB by Protein ID:ENSP00000479024
Original member Current member EBI ENST00000621536.4 ENSP00000480791.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000621536.4Link to Ensembl Protein Viewer:ENSP00000480791.1Re-query CCDS DB by Nucleotide ID:ENST00000621536Re-query CCDS DB by Protein ID:ENSP00000480791
Original member Current member EBI ENST00000619447.4 ENSP00000480980.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000619447.4Link to Ensembl Protein Viewer:ENSP00000480980.1Re-query CCDS DB by Nucleotide ID:ENST00000619447Re-query CCDS DB by Protein ID:ENSP00000480980
Original member Current member EBI ENST00000610990.4 ENSP00000481868.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000610990.4Link to Ensembl Protein Viewer:ENSP00000481868.1Re-query CCDS DB by Nucleotide ID:ENST00000610990Re-query CCDS DB by Protein ID:ENSP00000481868
Original member Current member NCBI NM_000800.5 NP_000791.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_000800.5Link to Protein Sequence:NP_000791.1Re-query CCDS DB by Nucleotide ID:NM_000800Re-query CCDS DB by Protein ID:NP_000791Link to BLAST:NP_000791.1
Original member Current member NCBI NM_001144892.3 NP_001138364.1 Accepted alive Link to Nucleotide Sequence:NM_001144892.3Link to Protein Sequence:NP_001138364.1Re-query CCDS DB by Nucleotide ID:NM_001144892Re-query CCDS DB by Protein ID:NP_001138364Link to BLAST:NP_001138364.1
Original member Current member NCBI NM_001144934.2 NP_001138406.1 Accepted alive Link to Nucleotide Sequence:NM_001144934.2Link to Protein Sequence:NP_001138406.1Re-query CCDS DB by Nucleotide ID:NM_001144934Re-query CCDS DB by Protein ID:NP_001138406Link to BLAST:NP_001138406.1
Original member Current member NCBI NM_001144935.2 NP_001138407.1 Accepted alive Link to Nucleotide Sequence:NM_001144935.2Link to Protein Sequence:NP_001138407.1Re-query CCDS DB by Nucleotide ID:NM_001144935Re-query CCDS DB by Protein ID:NP_001138407Link to BLAST:NP_001138407.1
Original member Current member NCBI NM_001257205.1 NP_001244134.1 Accepted alive Link to Nucleotide Sequence:NM_001257205.1Link to Protein Sequence:NP_001244134.1Re-query CCDS DB by Nucleotide ID:NM_001257205Re-query CCDS DB by Protein ID:NP_001244134Link to BLAST:NP_001244134.1
Original member Current member NCBI NM_001257207.2 NP_001244136.1 Accepted alive Link to Nucleotide Sequence:NM_001257207.2Link to Protein Sequence:NP_001244136.1Re-query CCDS DB by Nucleotide ID:NM_001257207Re-query CCDS DB by Protein ID:NP_001244136Link to BLAST:NP_001244136.1
Original member Current member NCBI NM_001257208.2 NP_001244137.1 Accepted alive Link to Nucleotide Sequence:NM_001257208.2Link to Protein Sequence:NP_001244137.1Re-query CCDS DB by Nucleotide ID:NM_001257208Re-query CCDS DB by Protein ID:NP_001244137Link to BLAST:NP_001244137.1
Original member Current member NCBI NM_001257209.1 NP_001244138.1 Accepted alive Link to Nucleotide Sequence:NM_001257209.1Link to Protein Sequence:NP_001244138.1Re-query CCDS DB by Nucleotide ID:NM_001257209Re-query CCDS DB by Protein ID:NP_001244138Link to BLAST:NP_001244138.1
Original member Current member NCBI NM_001257210.2 NP_001244139.1 Accepted alive Link to Nucleotide Sequence:NM_001257210.2Link to Protein Sequence:NP_001244139.1Re-query CCDS DB by Nucleotide ID:NM_001257210Re-query CCDS DB by Protein ID:NP_001244139Link to BLAST:NP_001244139.1
Original member Current member NCBI NM_001354951.2 NP_001341880.1 Accepted alive Link to Nucleotide Sequence:NM_001354951.2Link to Protein Sequence:NP_001341880.1Re-query CCDS DB by Nucleotide ID:NM_001354951Re-query CCDS DB by Protein ID:NP_001341880Link to BLAST:NP_001341880.1
Original member Current member NCBI NM_001354952.2 NP_001341881.1 Accepted alive Link to Nucleotide Sequence:NM_001354952.2Link to Protein Sequence:NP_001341881.1Re-query CCDS DB by Nucleotide ID:NM_001354952Re-query CCDS DB by Protein ID:NP_001341881Link to BLAST:NP_001341881.1
Original member Current member NCBI NM_001354953.2 NP_001341882.1 Accepted alive Link to Nucleotide Sequence:NM_001354953.2Link to Protein Sequence:NP_001341882.1Re-query CCDS DB by Nucleotide ID:NM_001354953Re-query CCDS DB by Protein ID:NP_001341882Link to BLAST:NP_001341882.1
Original member Current member NCBI NM_001354954.2 NP_001341883.1 Accepted alive Link to Nucleotide Sequence:NM_001354954.2Link to Protein Sequence:NP_001341883.1Re-query CCDS DB by Nucleotide ID:NM_001354954Re-query CCDS DB by Protein ID:NP_001341883Link to BLAST:NP_001341883.1
Original member Current member NCBI NM_001354955.2 NP_001341884.1 Accepted alive Link to Nucleotide Sequence:NM_001354955.2Link to Protein Sequence:NP_001341884.1Re-query CCDS DB by Nucleotide ID:NM_001354955Re-query CCDS DB by Protein ID:NP_001341884Link to BLAST:NP_001341884.1
Original member Current member NCBI NM_001354956.2 NP_001341885.1 Accepted alive Link to Nucleotide Sequence:NM_001354956.2Link to Protein Sequence:NP_001341885.1Re-query CCDS DB by Nucleotide ID:NM_001354956Re-query CCDS DB by Protein ID:NP_001341885Link to BLAST:NP_001341885.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000791.1 155 P05230-1 155 100% 0 0
NP_001138364.1 155 P05230-1 155 100% 0 0
NP_001138406.1 155 P05230-1 155 100% 0 0
NP_001138407.1 155 P05230-1 155 100% 0 0
NP_001244134.1 155 P05230-1 155 100% 0 0
NP_001244136.1 155 P05230-1 155 100% 0 0
NP_001244137.1 155 P05230-1 155 100% 0 0
NP_001244138.1 155 P05230-1 155 100% 0 0
NP_001244139.1 155 P05230-1 155 100% 0 0
NP_001341880.1 155 P05230-1 155 100% 0 0
NP_001341881.1 155 P05230-1 155 100% 0 0
NP_001341882.1 155 P05230-1 155 100% 0 0
NP_001341883.1 155 P05230-1 155 100% 0 0
NP_001341884.1 155 P05230-1 155 100% 0 0
NP_001341885.1 155 P05230-1 155 100% 0 0

Chromosomal Locations for CCDS 4275.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 142595290 142595484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 142600702 142600805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 142613959 142614127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (468 nt):
ATGGCTGAAGGGGAAATCACCACCTTCACAGCCCTGACCGAGAAGTTTAATCTGCCTCCAGGGAATTACA
AGAAGCCCAAACTCCTCTACTGTAGCAACGGGGGCCACTTCCTGAGGATCCTTCCGGATGGCACAGTGGA
TGGGACAAGGGACAGGAGCGACCAGCACATTCAGCTGCAGCTCAGTGCGGAAAGCGTGGGGGAGGTGTAT
ATAAAGAGTACCGAGACTGGCCAGTACTTGGCCATGGACACCGACGGGCTTTTATACGGCTCACAGACAC
CAAATGAGGAATGTTTGTTCCTGGAAAGGCTGGAGGAGAACCATTACAACACCTATATATCCAAGAAGCA
TGCAGAGAAGAATTGGTTTGTTGGCCTCAAGAAGAATGGGAGCTGCAAACGCGGTCCTCGGACTCACTAT
GGCCAGAAAGCAATCTTGTTTCTCCCCCTGCCAGTCTCTTCTGATTAA

Translation (155 aa):
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY
GQKAILFLPLPVSSD


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH