NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS93175.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
93175.1 Public Homo sapiens 22 SMIM45 24 110 108 CCDS HistoryNCBI Gene:339674Re-query CCDS DB by CCDS ID:93175.1Re-query CCDS DB by GeneID:339674See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 24, NCBI annotation release 110, Ensembl annotation release 108

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 93175.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000381348.4 ENSP00000499702.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381348.4Link to Ensembl Protein Viewer:ENSP00000499702.1Re-query CCDS DB by Nucleotide ID:ENST00000381348Re-query CCDS DB by Protein ID:ENSP00000499702
Original member Current member NCBI NM_001395940.1 NP_001382869.1 Accepted alive Link to Nucleotide Sequence:NM_001395940.1Link to Protein Sequence:NP_001382869.1Re-query CCDS DB by Nucleotide ID:NM_001395940Re-query CCDS DB by Protein ID:NP_001382869Link to BLAST:NP_001382869.1
Original member Current member NCBI NM_001395941.1 NP_001382870.1 Accepted alive Link to Nucleotide Sequence:NM_001395941.1Link to Protein Sequence:NP_001382870.1Re-query CCDS DB by Nucleotide ID:NM_001395941Re-query CCDS DB by Protein ID:NP_001382870Link to BLAST:NP_001382870.1
Original member Current member NCBI NM_001395942.1 NP_001382871.1 Accepted alive Link to Nucleotide Sequence:NM_001395942.1Link to Protein Sequence:NP_001382871.1Re-query CCDS DB by Nucleotide ID:NM_001395942Re-query CCDS DB by Protein ID:NP_001382871Link to BLAST:NP_001382871.1
Original member Current member NCBI NM_001395943.1 NP_001382872.1 Accepted alive Link to Nucleotide Sequence:NM_001395943.1Link to Protein Sequence:NP_001382872.1Re-query CCDS DB by Nucleotide ID:NM_001395943Re-query CCDS DB by Protein ID:NP_001382872Link to BLAST:NP_001382872.1
Original member Current member NCBI NM_001395944.1 NP_001382873.1 Accepted alive Link to Nucleotide Sequence:NM_001395944.1Link to Protein Sequence:NP_001382873.1Re-query CCDS DB by Nucleotide ID:NM_001395944Re-query CCDS DB by Protein ID:NP_001382873Link to BLAST:NP_001382873.1
Original member Current member NCBI NM_001395945.1 NP_001382874.1 Accepted alive Link to Nucleotide Sequence:NM_001395945.1Link to Protein Sequence:NP_001382874.1Re-query CCDS DB by Nucleotide ID:NM_001395945Re-query CCDS DB by Protein ID:NP_001382874Link to BLAST:NP_001382874.1
Original member Current member NCBI NM_001395946.1 NP_001382875.1 Accepted alive Link to Nucleotide Sequence:NM_001395946.1Link to Protein Sequence:NP_001382875.1Re-query CCDS DB by Nucleotide ID:NM_001395946Re-query CCDS DB by Protein ID:NP_001382875Link to BLAST:NP_001382875.1
Original member Current member NCBI NM_001395947.1 NP_001382876.1 Accepted alive Link to Nucleotide Sequence:NM_001395947.1Link to Protein Sequence:NP_001382876.1Re-query CCDS DB by Nucleotide ID:NM_001395947Re-query CCDS DB by Protein ID:NP_001382876Link to BLAST:NP_001382876.1
Original member Current member NCBI NM_001395948.1 NP_001382877.1 Accepted alive Link to Nucleotide Sequence:NM_001395948.1Link to Protein Sequence:NP_001382877.1Re-query CCDS DB by Nucleotide ID:NM_001395948Re-query CCDS DB by Protein ID:NP_001382877Link to BLAST:NP_001382877.1
Original member Current member NCBI NM_001395949.1 NP_001382878.1 Accepted alive Link to Nucleotide Sequence:NM_001395949.1Link to Protein Sequence:NP_001382878.1Re-query CCDS DB by Nucleotide ID:NM_001395949Re-query CCDS DB by Protein ID:NP_001382878Link to BLAST:NP_001382878.1
Original member Current member NCBI NM_001395950.1 NP_001382879.1 Accepted alive Link to Nucleotide Sequence:NM_001395950.1Link to Protein Sequence:NP_001382879.1Re-query CCDS DB by Nucleotide ID:NM_001395950Re-query CCDS DB by Protein ID:NP_001382879Link to BLAST:NP_001382879.1
Original member Current member NCBI NM_001395951.1 NP_001382880.1 Accepted alive Link to Nucleotide Sequence:NM_001395951.1Link to Protein Sequence:NP_001382880.1Re-query CCDS DB by Nucleotide ID:NM_001395951Re-query CCDS DB by Protein ID:NP_001382880Link to BLAST:NP_001382880.1
Original member Current member NCBI NM_001395952.1 NP_001382881.1 Accepted alive Link to Nucleotide Sequence:NM_001395952.1Link to Protein Sequence:NP_001382881.1Re-query CCDS DB by Nucleotide ID:NM_001395952Re-query CCDS DB by Protein ID:NP_001382881Link to BLAST:NP_001382881.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001382869.1 68 A0A590UK83 68 100% 0 0
NP_001382870.1 68 A0A590UK83 68 100% 0 0
NP_001382871.1 68 A0A590UK83 68 100% 0 0
NP_001382872.1 68 A0A590UK83 68 100% 0 0
NP_001382873.1 68 A0A590UK83 68 100% 0 0
NP_001382874.1 68 A0A590UK83 68 100% 0 0
NP_001382875.1 68 A0A590UK83 68 100% 0 0
NP_001382876.1 68 A0A590UK83 68 100% 0 0
NP_001382877.1 68 A0A590UK83 68 100% 0 0
NP_001382878.1 68 A0A590UK83 68 100% 0 0
NP_001382879.1 68 A0A590UK83 68 100% 0 0
NP_001382880.1 68 A0A590UK83 68 100% 0 0
NP_001382881.1 68 A0A590UK83 68 100% 0 0

Chromosomal Locations for CCDS 93175.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 41957686 41957892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (207 nt):
ATGCCGCACTTCCTGGACTGGTTCGTGCCGGTCTACTTGGTCATCTCGGTCCTCATTCTGGTGGGCTTCG
GCGCCTGCATCTACTACTTCGAGCCGGGCCTGCAGGAGGCGCACAAGTGGCGCATGCAGCGCCCCCTGGT
GGACCGCGACCTCCGCAAGACGCTAATGGTGCGCGACAACCTGGCCTTCGGCGGCCCGGAGGTCTGA

Translation (68 aa):
MPHFLDWFVPVYLVISVLILVGFGACIYYFEPGLQEAHKWRMQRPLVDRDLRKTLMVRDNLAFGGPEV


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH