NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS75663.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
75663.1 Public Homo sapiens 7 CYREN 24 110 108 CCDS HistoryNCBI Gene:78996Re-query CCDS DB by CCDS ID:75663.1Re-query CCDS DB by GeneID:78996See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 75663.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000617987.1 ENSP00000480430.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000617987.1Link to Ensembl Protein Viewer:ENSP00000480430.1Re-query CCDS DB by Nucleotide ID:ENST00000617987Re-query CCDS DB by Protein ID:ENSP00000480430
Original member Current member NCBI NM_001243749.2 NP_001230678.1 Accepted alive Link to Nucleotide Sequence:NM_001243749.2Link to Protein Sequence:NP_001230678.1Re-query CCDS DB by Nucleotide ID:NM_001243749Re-query CCDS DB by Protein ID:NP_001230678Link to BLAST:NP_001230678.1
Original member Current member NCBI NM_001243751.2 NP_001230680.1 Accepted alive Link to Nucleotide Sequence:NM_001243751.2Link to Protein Sequence:NP_001230680.1Re-query CCDS DB by Nucleotide ID:NM_001243751Re-query CCDS DB by Protein ID:NP_001230680Link to BLAST:NP_001230680.1
Original member Current member NCBI NM_001243752.2 NP_001230681.1 Accepted alive Link to Nucleotide Sequence:NM_001243752.2Link to Protein Sequence:NP_001230681.1Re-query CCDS DB by Nucleotide ID:NM_001243752Re-query CCDS DB by Protein ID:NP_001230681Link to BLAST:NP_001230681.1
Original member Current member NCBI NM_001243753.2 NP_001230682.1 Accepted alive Link to Nucleotide Sequence:NM_001243753.2Link to Protein Sequence:NP_001230682.1Re-query CCDS DB by Nucleotide ID:NM_001243753Re-query CCDS DB by Protein ID:NP_001230682Link to BLAST:NP_001230682.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001230678.1 69 Q9BWK5-4 69 100% 0 0
NP_001230680.1 69 Q9BWK5-4 69 100% 0 0
NP_001230681.1 69 Q9BWK5-4 69 100% 0 0
NP_001230682.1 69 Q9BWK5-4 69 100% 0 0

Chromosomal Locations for CCDS 75663.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 135167772 135167807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 135168749 135168922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (210 nt):
ATGGAAACCTTACAATCCGAGACTAAAACGAGGGTCCTTCCCTCATGGCTGACAGCCCAGGTGGCTACAA
AGAATGTGGCACCAATGAAGGCCCCCAAGAGGATGAGAATGGCAGCAGTGCCAGTGGCAGCAGCAAGGTG
CGACAGCTCTGGTCAGAAGACTCCTGCGAATCTGACTCCCTGCGACAAGGACTGTGTACTGCATGAATGA

Translation (69 aa):
METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARCDSSGQKTPANLTPCDKDCVLHE


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH