NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS11545.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11545.1 Public Homo sapiens 17 GNGT2 24 110 108 CCDS HistoryNCBI Gene:2793Re-query CCDS DB by CCDS ID:11545.1Re-query CCDS DB by GeneID:2793See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11545.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000300406.6 ENSP00000300406.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000300406.6Link to Ensembl Protein Viewer:ENSP00000300406.2Re-query CCDS DB by Nucleotide ID:ENST00000300406Re-query CCDS DB by Protein ID:ENSP00000300406
Original member Current member EBI ENST00000507680.6 ENSP00000421710.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000507680.6Link to Ensembl Protein Viewer:ENSP00000421710.1Re-query CCDS DB by Nucleotide ID:ENST00000507680Re-query CCDS DB by Protein ID:ENSP00000421710
Original member Current member EBI ENST00000511673.1 ENSP00000422879.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000511673.1Link to Ensembl Protein Viewer:ENSP00000422879.1Re-query CCDS DB by Nucleotide ID:ENST00000511673Re-query CCDS DB by Protein ID:ENSP00000422879
Original member Current member EBI ENST00000515635.5 ENSP00000423924.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000515635.5Link to Ensembl Protein Viewer:ENSP00000423924.1Re-query CCDS DB by Nucleotide ID:ENST00000515635Re-query CCDS DB by Protein ID:ENSP00000423924
Original member Current member EBI ENST00000511277.5 ENSP00000426022.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000511277.5Link to Ensembl Protein Viewer:ENSP00000426022.1Re-query CCDS DB by Nucleotide ID:ENST00000511277Re-query CCDS DB by Protein ID:ENSP00000426022
Original member Current member NCBI NM_001198754.2 NP_001185683.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001198754.2Link to Protein Sequence:NP_001185683.1Re-query CCDS DB by Nucleotide ID:NM_001198754Re-query CCDS DB by Protein ID:NP_001185683Link to BLAST:NP_001185683.1
Original member Current member NCBI NM_001198755.1 NP_001185684.1 Accepted alive Link to Nucleotide Sequence:NM_001198755.1Link to Protein Sequence:NP_001185684.1Re-query CCDS DB by Nucleotide ID:NM_001198755Re-query CCDS DB by Protein ID:NP_001185684Link to BLAST:NP_001185684.1
Original member Current member NCBI NM_001198756.1 NP_001185685.1 Accepted alive Link to Nucleotide Sequence:NM_001198756.1Link to Protein Sequence:NP_001185685.1Re-query CCDS DB by Nucleotide ID:NM_001198756Re-query CCDS DB by Protein ID:NP_001185685Link to BLAST:NP_001185685.1
Original member Current member NCBI NM_031498.2 NP_113686.1 Accepted alive Link to Nucleotide Sequence:NM_031498.2Link to Protein Sequence:NP_113686.1Re-query CCDS DB by Nucleotide ID:NM_031498Re-query CCDS DB by Protein ID:NP_113686Link to BLAST:NP_113686.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001185683.1 69 O14610 69 100% 0 0
NP_001185684.1 69 O14610 69 100% 0 0
NP_001185685.1 69 O14610 69 100% 0 0
NP_113686.1 69 O14610 69 100% 0 0

Chromosomal Locations for CCDS 11545.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 49206757 49206882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 49207339 49207422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (210 nt):
ATGGCCCAGGATCTCAGCGAGAAGGACCTGTTGAAGATGGAGGTGGAGCAGCTGAAGAAAGAAGTGAAAA
AC
ACAAGAATTCCGATTTCCAAAGCGGGAAAGGAAATCAAGGAGTACGTGGAGGCCCAAGCAGGAAACGA
T
CCTTTTCTCAAAGGCATCCCTGAGGACAAGAATCCCTTCAAGGAGAAAGGTGGCTGTCTGATAAGCTGA


Translation (69 aa):
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser