NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS7542.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7542.2 Public Homo sapiens 10 BORCS7 24 110 108 CCDS HistoryNCBI Gene:119032Re-query CCDS DB by CCDS ID:7542.2See the combined annotation on chromosome 10 in Sequence Viewer

Public Note for CCDS 7542.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and conservation data. Two possible start codons are present in this update. Due to leaky scanning by ribosomes, it is possible that some ribosomes may initiate translation from the upstream AUG codon while others start from the downstream AUG. Translation initiation from the downstream AUG would result in a protein that is 1 aa shorter at the N-terminus.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 7542.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000299353.6 ENSP00000299353.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000299353.6Link to Ensembl Protein Viewer:ENSP00000299353.5Re-query CCDS DB by Nucleotide ID:ENST00000299353Re-query CCDS DB by Protein ID:ENSP00000299353
Original member Current member EBI ENST00000339834.10 ENSP00000342331.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000339834.10Link to Ensembl Protein Viewer:ENSP00000342331.5Re-query CCDS DB by Nucleotide ID:ENST00000339834Re-query CCDS DB by Protein ID:ENSP00000342331
Original member Current member EBI ENST00000369883.3 ENSP00000358899.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000369883.3Link to Ensembl Protein Viewer:ENSP00000358899.3Re-query CCDS DB by Nucleotide ID:ENST00000369883Re-query CCDS DB by Protein ID:ENSP00000358899
Original member Current member NCBI NM_001136200.2 NP_001129672.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001136200.2Link to Protein Sequence:NP_001129672.1Re-query CCDS DB by Nucleotide ID:NM_001136200Re-query CCDS DB by Protein ID:NP_001129672Link to BLAST:NP_001129672.1
Original member Current member NCBI NM_144591.5 NP_653192.2 Accepted alive Link to Nucleotide Sequence:NM_144591.5Link to Protein Sequence:NP_653192.2Re-query CCDS DB by Nucleotide ID:NM_144591Re-query CCDS DB by Protein ID:NP_653192Link to BLAST:NP_653192.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001129672.1 106 Q96B45 106 100% 0 0
NP_653192.2 106 Q96B45 106 100% 0 0

Chromosomal Locations for CCDS 7542.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 102854287 102854427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 102860332 102860394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 102860498 102860541 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 102862160 102862180 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 102862873 102862924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (321 nt):
ATGATGGCGACTGGAACGCCAGAGTCTCAAGCGCGGTTCGGTCAGTCCGTGAAGGGGCTTCTCACGGAGA
AGGTGACCACCTGTGGTACTGACGTAATCGCGCTCACCAAGCAGGTGCTGAAAGGCTCCCGGAGCTCCGA
GCTGCTAGGTCAGGCAGCTCGAAACATGGTACTCCAGGAAGATGCCATCTTGCACTCAGAAGATAGTTTA
AGGAAGATGGCAATAATAACAACACATCTTCAATACCAGCAAGAAGCTATTCAGAAGAATGTTGAACAGT
CATCGGATCTACAGGACCAGTTGAATCATCTGTTGAAATAG

Translation (106 aa):
MMATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSL
RKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH