NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, December 17, 2024, starting at 8:00 a.m. EST for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS10930.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10930.1 Public Homo sapiens 16 CMC2 24 110 108 CCDS HistoryNCBI Gene:56942Re-query CCDS DB by CCDS ID:10930.1Re-query CCDS DB by GeneID:56942See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10930.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000219400.8 ENSP00000219400.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000219400.8Link to Ensembl Protein Viewer:ENSP00000219400.3Re-query CCDS DB by Nucleotide ID:ENST00000219400Re-query CCDS DB by Protein ID:ENSP00000219400
Original member Current member EBI ENST00000565650.5 ENSP00000455457.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000565650.5Link to Ensembl Protein Viewer:ENSP00000455457.2Re-query CCDS DB by Nucleotide ID:ENST00000565650Re-query CCDS DB by Protein ID:ENSP00000455457
Original member Current member EBI ENST00000565914.5 ENSP00000455723.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000565914.5Link to Ensembl Protein Viewer:ENSP00000455723.1Re-query CCDS DB by Nucleotide ID:ENST00000565914Re-query CCDS DB by Protein ID:ENSP00000455723
Original member Current member EBI ENST00000564249.5 ENSP00000456841.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000564249.5Link to Ensembl Protein Viewer:ENSP00000456841.1Re-query CCDS DB by Nucleotide ID:ENST00000564249Re-query CCDS DB by Protein ID:ENSP00000456841
Original member Current member NCBI NM_001351967.2 NP_001338896.1 Accepted alive Link to Nucleotide Sequence:NM_001351967.2Link to Protein Sequence:NP_001338896.1Re-query CCDS DB by Nucleotide ID:NM_001351967Re-query CCDS DB by Protein ID:NP_001338896Link to BLAST:NP_001338896.1
Original member Current member NCBI NM_001351968.2 NP_001338897.1 Accepted alive Link to Nucleotide Sequence:NM_001351968.2Link to Protein Sequence:NP_001338897.1Re-query CCDS DB by Nucleotide ID:NM_001351968Re-query CCDS DB by Protein ID:NP_001338897Link to BLAST:NP_001338897.1
Original member Current member NCBI NM_001351970.2 NP_001338899.1 Accepted alive Link to Nucleotide Sequence:NM_001351970.2Link to Protein Sequence:NP_001338899.1Re-query CCDS DB by Nucleotide ID:NM_001351970Re-query CCDS DB by Protein ID:NP_001338899Link to BLAST:NP_001338899.1
Original member Current member NCBI NM_020188.5 NP_064573.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_020188.5Link to Protein Sequence:NP_064573.1Re-query CCDS DB by Nucleotide ID:NM_020188Re-query CCDS DB by Protein ID:NP_064573Link to BLAST:NP_064573.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001338896.1 79 Q9NRP2 79 100% 0 0
NP_001338897.1 79 Q9NRP2 79 100% 0 0
NP_001338899.1 79 Q9NRP2 79 100% 0 0
NP_064573.1 79 Q9NRP2 79 100% 0 0

Chromosomal Locations for CCDS 10930.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 80976093 80976179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 80981806 80981877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 80997314 80997394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (240 nt):
ATGCATCCTGACTTATCTCCACACTTGCACACTGAAGAATGCAACGTCTTGATTAACTTGCTTAAGGAAT
GTCACAAAAATCACAACATTCTGAAATTTTTTGGTTATTGTAATGATGTTGATCGGGAGTTGAGAAAATG
CCTGAAGAATGAGTACGTAGAAAACAGGACCAAGAGCAGGGAGCATGGCATTGCAATGCGAAAGAAACTT
TTTAATCCTCCAGAGGAATCCGAAAAATAA

Translation (79 aa):
MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
FNPPEESEK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH