NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS2126.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2126.1 Public Homo sapiens 2 DBI 24 110 108 CCDS HistoryNCBI Gene:1622Re-query CCDS DB by CCDS ID:2126.1Re-query CCDS DB by GeneID:1622See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 2126.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000311521.8 ENSP00000311117.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000311521.8Link to Ensembl Protein Viewer:ENSP00000311117.4Re-query CCDS DB by Nucleotide ID:ENST00000311521Re-query CCDS DB by Protein ID:ENSP00000311117
Original member Current member EBI ENST00000409094.5 ENSP00000386486.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000409094.5Link to Ensembl Protein Viewer:ENSP00000386486.1Re-query CCDS DB by Nucleotide ID:ENST00000409094Re-query CCDS DB by Protein ID:ENSP00000386486
Original member Current member EBI ENST00000535757.5 ENSP00000439012.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000535757.5Link to Ensembl Protein Viewer:ENSP00000439012.1Re-query CCDS DB by Nucleotide ID:ENST00000535757Re-query CCDS DB by Protein ID:ENSP00000439012
Original member Current member NCBI NM_001178042.4 NP_001171513.1 Accepted alive Link to Nucleotide Sequence:NM_001178042.4Link to Protein Sequence:NP_001171513.1Re-query CCDS DB by Nucleotide ID:NM_001178042Re-query CCDS DB by Protein ID:NP_001171513Link to BLAST:NP_001171513.1
Original member Current member NCBI NM_001282633.3 NP_001269562.1 Accepted alive Link to Nucleotide Sequence:NM_001282633.3Link to Protein Sequence:NP_001269562.1Re-query CCDS DB by Nucleotide ID:NM_001282633Re-query CCDS DB by Protein ID:NP_001269562Link to BLAST:NP_001269562.1
Original member Current member NCBI NM_001282634.3 NP_001269563.1 Accepted alive Link to Nucleotide Sequence:NM_001282634.3Link to Protein Sequence:NP_001269563.1Re-query CCDS DB by Nucleotide ID:NM_001282634Re-query CCDS DB by Protein ID:NP_001269563Link to BLAST:NP_001269563.1
Original member Current member NCBI NM_001282635.3 NP_001269564.1 Accepted alive Link to Nucleotide Sequence:NM_001282635.3Link to Protein Sequence:NP_001269564.1Re-query CCDS DB by Nucleotide ID:NM_001282635Re-query CCDS DB by Protein ID:NP_001269564Link to BLAST:NP_001269564.1
Original member Current member NCBI NM_020548.9 NP_065438.1 Accepted alive Link to Nucleotide Sequence:NM_020548.9Link to Protein Sequence:NP_065438.1Re-query CCDS DB by Nucleotide ID:NM_020548Re-query CCDS DB by Protein ID:NP_065438Link to BLAST:NP_065438.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001171513.1 104 P07108-2 104 100% 0 0
NP_001269562.1 104 P07108-2 104 100% 0 0
NP_001269563.1 104 P07108-2 104 100% 0 0
NP_001269564.1 104 P07108-2 104 100% 0 0
NP_065438.1 104 P07108-2 104 100% 0 0

Chromosomal Locations for CCDS 2126.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 119367585 119367644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 119368188 119368305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 119370740 119370802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 119372245 119372318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (315 nt):
ATGTGGGGCGACCTCTGGCTCCTCCCGCCTGCCTCTGCCAATCCGGGCACTGGGACAGAGGCTGAGTTTG
AG
AAAGCTGCAGAGGAGGTTAGGCACCTTAAGACCAAGCCATCGGATGAGGAGATGCTGTTCATCTATGG
C
CACTACAAACAAGCAACTGTGGGCGACATAAATACAGAACGGCCCGGGATGTTGGACTTCACGGGCAAG
GCC
AAGTGGGATGCCTGGAATGAGCTGAAAGGGACTTCCAAGGAAGATGCCATGAAAGCTTACATCAACA
AA
GTAGAAGAGCTAAAGAAAAAATACGGGATATGA


Translation (104 aa):
MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGK
A
KWDAWNELK
GTSKEDAMKAYINKVEELKKKYGI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser