NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, January 28, 2025, starting at 8:00 a.m. EST for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS12442.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12442.1 Public Homo sapiens 19 FXYD3 24 110 108 CCDS HistoryNCBI Gene:5349Re-query CCDS DB by CCDS ID:12442.1Re-query CCDS DB by GeneID:5349See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 12442.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000604404.6 ENSP00000474438.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000604404.6Link to Ensembl Protein Viewer:ENSP00000474438.1Re-query CCDS DB by Nucleotide ID:ENST00000604404Re-query CCDS DB by Protein ID:ENSP00000474438
Original member Current member EBI ENST00000604621.5 ENSP00000474526.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000604621.5Link to Ensembl Protein Viewer:ENSP00000474526.1Re-query CCDS DB by Nucleotide ID:ENST00000604621Re-query CCDS DB by Protein ID:ENSP00000474526
Original member Current member EBI ENST00000603181.5 ENSP00000474851.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000603181.5Link to Ensembl Protein Viewer:ENSP00000474851.1Re-query CCDS DB by Nucleotide ID:ENST00000603181Re-query CCDS DB by Protein ID:ENSP00000474851
Original member Current member NCBI NM_001136011.2 NP_001129483.1 Accepted alive Link to Nucleotide Sequence:NM_001136011.2Link to Protein Sequence:NP_001129483.1Re-query CCDS DB by Nucleotide ID:NM_001136011Re-query CCDS DB by Protein ID:NP_001129483Link to BLAST:NP_001129483.1
Original member Current member NCBI NM_001387349.1 NP_001374278.1 Accepted alive Link to Nucleotide Sequence:NM_001387349.1Link to Protein Sequence:NP_001374278.1Re-query CCDS DB by Nucleotide ID:NM_001387349Re-query CCDS DB by Protein ID:NP_001374278Link to BLAST:NP_001374278.1
Original member Current member NCBI NM_001387350.1 NP_001374279.1 Accepted alive Link to Nucleotide Sequence:NM_001387350.1Link to Protein Sequence:NP_001374279.1Re-query CCDS DB by Nucleotide ID:NM_001387350Re-query CCDS DB by Protein ID:NP_001374279Link to BLAST:NP_001374279.1
Original member Current member NCBI NM_001387352.1 NP_001374281.1 Accepted alive Link to Nucleotide Sequence:NM_001387352.1Link to Protein Sequence:NP_001374281.1Re-query CCDS DB by Nucleotide ID:NM_001387352Re-query CCDS DB by Protein ID:NP_001374281Link to BLAST:NP_001374281.1
Original member Current member NCBI NM_001387353.1 NP_001374282.1 Accepted alive Link to Nucleotide Sequence:NM_001387353.1Link to Protein Sequence:NP_001374282.1Re-query CCDS DB by Nucleotide ID:NM_001387353Re-query CCDS DB by Protein ID:NP_001374282Link to BLAST:NP_001374282.1
Original member Current member NCBI NM_005971.4 NP_005962.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_005971.4Link to Protein Sequence:NP_005962.1Re-query CCDS DB by Nucleotide ID:NM_005971Re-query CCDS DB by Protein ID:NP_005962Link to BLAST:NP_005962.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001129483.1 87 Q14802-1 87 100% 0 0
NP_001374278.1 87 Q14802-1 87 100% 0 0
NP_001374279.1 87 Q14802-1 87 100% 0 0
NP_001374281.1 87 Q14802-1 87 100% 0 0
NP_001374282.1 87 Q14802-1 87 100% 0 0
NP_005962.1 87 Q14802-1 87 100% 0 0

Chromosomal Locations for CCDS 12442.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 35119377 35119416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35121078 35121110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35121222 35121245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35122765 35122839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35122918 35122954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35123271 35123308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35123441 35123457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (264 nt):
ATGCAGAAGGTGACCCTGGGCCTGCTTGTGTTCCTGGCAGGCTTTCCTGTCCTGGACGCCAATGACCTAG
AA
GATAAAAACAGTCCTTTCTACTATGACTGGCACAGCCTCCAGGTTGGCGGGCTCATCTGCGCTGGGGT
T
CTGTGCGCCATGGGCATCATCATCGTCATGAGTGCAAAATGCAAATGCAAGTTTGGCCAGAAGTCCGGT
CAC
CATCCAGGGGAGACTCCACCTCTCATCACCCCAGGCTCAGCCCAAAGCTGA


Translation (87 aa):
MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG
H
HPGETPPLITP
GSAQS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser